Rintech Home

About Rintech

 

Products

Search Products


New 2011
New 2010
New 2009
New 2008
New 2007
New Products, 4/2006
New Products, 3/2006
New Products, 2/2006
New Products, 1/2006(A)
New Products, 1/2006(B)
New Products, 1/2005
New Products, 6/04
New Products
Amino Acids
Amino Alcohols
Aromatics
Benzocycles
Benzodiazepins
Biphenyls
Catechol Der.
2H-Isoquinolines
Diphenylethers
Heterocycles(5)
Heterocycles
IndolineDer
Phenylethylamines
Prolines
Quinolines
4H-Isoquinolines
Other Chemicals

BioProducts(New, 4/2005)
Green Tea/Catechin

Flosser, New (2006)

 

Services

Contact Us

 

 

Gaithersburg Business List

Kamp Pharmaceuticals Co., Ltd. (Click here)!
Welcome to inquiry through RINTECH!


Chinese Herb Related Products (Click here)!
Welcome to inquiry RINTECH!

 

New 2011

 
Product # Category Structure Image Chemical Name Formula CAS #
R11-001 2011 Tigecycline 220620-09-7
R11-002 2011 9-Amino-minocycline 149934-21-4
R11-003 2011 9-Amino-minocycline 149934-20-3
R11-004 2011 Minocycline HCl 13614-98-7
R11-005 2011 L-Phenylglycinamide 6485-52-5
R11-006 2011 D-Phenylglycinamide 6485-67-2
R11-007 2011 Pirfenidone 53179-1-3-8
R11-008 2011 Clofarabine 123318-82-1
R11-009 2011 Agomelatine 138112-76-2
R11-010 2011 Alvimopan 170098-38-1
R11-011 2011 Imidafenacin 170105-16-5
R11-012 2011 Ascomycin 11011-38-4
R11-013 2011 Geldanamycin 30562-34-6
R11-014 2011 Rapamycin/Sirolimus 53123-88-9
R11-015 2011 Teichomycin 61036-62-2
R11-016 2011 Ramoplanin 76168-82-6
R11-017 2011 Daptomycin 103060-53-3
R11-018 2011 Tacrolimus 104987-11-3
R11-019 2011 Pimecrolimus 137071-32-0
R11-020 2011 Pristinamycin,Virginiamycin 11006-76-1
R11-021 2011 Mizoribine 50924-49-7
R11-022 2011 Echinocandin B 79411-15-7
R11-023 2011 Pneumocandin B0 135575-42-7
R11-024 2011 Pneumocandin A0 539823-80-8
R11-025 2011 Micafungin 235114-32-6
R11-026 2011 Anidulafungin 166663-25-8
R11-027 2011 Micafungin Intermediate FR901379,WF11899A
R11-028 2011 Micafungin Precursor FR179642
R11-029 2011 Anidulafungin Precursor
R11-030 2011 Entecavir 142217-69-4
R11-031 2011 Sitagliptin phosphate 654671-78-0
R11-032 2011 Silodosin 160970-54-7
R11-033 2011 Minodronic Acid 180064-38-4
R11-034 2011 Aliskiren Hemifumarare 173334-57-1
R11-035 2011 Lacosamide 175481-36-4
R11-036 2011 Pitavastatin calcium 147526-32-7
R11-037 2011 Rosuvastatin Calcium 147098-20-2
R11-038 2011 Febuxostat Intermediates 160844-75-7
R11-039 2011 1-aminocyclopropane methanol hydrochloride 115652-52-3
R11-040 2011 1H-pyrazole-3-carboxylic acid methyl ester 15336-34-4
R11-041 2011 2-bromo-4-methyl benzoic acid 7697-27-0
R11-042 2011 Methyl-2-bromo-4-bromomethylbenzoate 128577-48-0
R11-043 2011 cyclopropanesulfonamide 154350-29-5
R11-044 2011 4-methyl-6-chloropyrimidine 3435-25-4
R11-045 2011 5-chloro-2-pyrazine carboxylic acid 36070-80-1
R11-046 2011 methyl-5-hydroxy-2-pyrazinecarboxylate 13924-95-3
R11-047 2011 5-hydroxy-2-pyrazine carboxylic acid 34604-60-9
R11-048 2011 1-aminocyclopropane methanol hydrochloride 115652-52-3
R11-049 2011 2-bromo-4-methyl benzoic acid 7697-27-0
R11-050 2011 Methyl-2-bromo-4-bromomethylbenzoate 128577-48-0
R11-051 2011 cyclopropanesulfonamide 154350-29-5
R11-052 2011 4-methyl-6-chloropyrimidine 3435-25-4
R11-053 2011 phenazine;dibenzopyrazine C12H8N2 92-82-0
R11-054 2011 4,4'-Bipyridine C10H8N2 553-26-4
R11-055 2011 4,4'-Dibromobiphenyl C12H8Br2 92-86-4
R11-056 2011 2-Methyl anthraquinone C15H10O2 84-54-8
R11-057 2011 Denatonium benzoate C28H34N2O3 3734-33-6
R11-058 2011 Magnesium thiosulfate hexahydrate MgS2O3·6H2O 10124-53-5
R11-059 2011 Methyl-1H-pyrazol-3-yl)methylamine 1185158-48-8
R11-060 2011 methyl-1H-pyrazol-5-yl)methylamine 863548-52-1
R11-061 2011 1-(4,5-dichloro-1-methyl-1H-pyrazol-3-yl)methanamine 1006320-03-1
R11-062 2011 1-(4-chloro-1-methyl-1H-pyrazol-5-yl)methanamine 1184977-03-4
R11-063 2011 Methyl-1H-1,2,4-triazole-5-methanamine 244639-03-0
R11-064 2011 Aminomethylthiazole hydrochloride 55661-33-1
R11-065 2011 1,3-thiazol-5-ylmethylamine 131052-46-5
R11-066 2011 C-(2-Chloro-thiazol-5-yl)-methylamine hydrochloride 120740-08-1
R11-067 2011 2-(Trifluoromethyl)pyridin-5-ylboronic acid 868662-36-6
R11-068 2011 2-bromo-6-methyl- Pyrazine 914452-71-4
R11-069 2011 2-bromo- Pyrazine 56423-63-3
R11-070 2011 Pyrazin-2-yl boronic acid 762263-64-9
R11-071 2011 Quaternium-82 65059-61-2
R11-072 2011 Potassium 2-hydroxy-4-methoxybenzoate 152312-71-5
R11-073 2011 Deoxyarbutin 53936-56-4
R11-074 2011 3-O-Ethyl Ascorbyl Ether 86404-04-8
R11-075 2011 HYDROVANCE 2078-71-9
R11-076 2011 Procystein 19771-63-2
R11-077 2011 maltitol C12H24O11 585-88-6
R11-078 2011 xylose C5H10O5 25990-60-7
R11-079 2011 potassium sorbate C6H7KO2 24634-61-5
R11-080 2011 L-CYSTEINE C3H7NO2S 52-90-4
R11-081 2011 modified starch 9045-28-7
R11-082 2011 Succinic acid C4H6O4 110-15-6
R11-083 2011 Vanillin C8H8O3 121-33-5
R11-084 2011 Ethyl Vanillin C9H10O3 121-32-4
R11-085 2011 Citric Acid Monohydrate C6H8O7.H2O 5949-29-1
R11-086 2011 Dehydroacetic acid sodium; Sodium dehydroacetic acid; Sodium dehydroacetate C8H7NaO4 4418-26-2
R11-087 2011 Sorbitol; Dulcitol C6H14O6 608-66-2
R11-088 2011 sodium benzoate C7H5NaO2 532-32-1
R11-089 2011 Vitamin C C6H8O6 50-81-7
R11-090 2011 Sucrose octaacetate C28H38O19 126-14-7
R11-091 2011 Sorbic Acid C6H8O2 91751-55-2
R11-092 2011 sodium nitrite NNaO2 7632-00-0
R11-093 2011 N,N'-Dicyclohexyl-4-morpholinecarboxamidine 4975-73-9
R11-094 2011 Phenyl vinyl sulfone 5535-48-8
R11-095 2011 Arundic acid (Decorin); (R)-2-Propyloctanoic acid C11H22O2 185517-21-9
R11-096 2011 1-Naphthol C10H8O 90-15-3
R11-097 2011 ACTH (1-24), Human SYSMEHFRWGKPVGKKRRPVKVYP
R11-098 2011 Angiotensins I, Human DRVYIHPFHL
R11-099 2011 (Arg)7 RRRRRRR
R11-100 2011 (Arg)8 RRRRRRRR
R11-1000 2011 (R)-3-Pyrrolidinol hydrochloride C4H9NO.HCl 104706-47-0
R11-1001 2011 1-Benzyl-3-pyrrolidinone C11H13NO 775-16-6
R11-1002 2011 (S)-1-N-Boc-4-N-Fmoc-piperazine 2-carboxylic acid C25H28N2O6 1034574-30-5
R11-1003 2011 4-Boc-1-Fmoc-2-piperazinecarboxylic acid C25H28N2O6 183742-23-6
R11-1004 2011 (R)-1-N-Boc-4-N-Fmoc-2-Piperazine carboxylic acid C25H28N2O6 209593-18-0
R11-1005 2011 1-Boc-4-Fmoc-2-piperazinecarboxylic acid C25H28N2O6 218278-58-1
R11-1006 2011 N-1-Boc-N-4-Cbz-2-PIPERAZINE CARBOXYLIC ACID C18H24N2O6 149057-19-2
R11-1007 2011 N-4-Boc-N-1-Cbz-2-piperazinecarboxylic acid C18H24N2O6 126937-41-5
R11-1008 2011 R-N-4-Boc-N-1-Cbz-2-piperazine carboxylic acid C18H24N2O6 954388-33-1
R11-1009 2011 S-N-4-Boc-N-1-Cbz-2-piperazine carboxylic acid C18H24N2O6 150407-69-5
R11-101 2011 (Arg)9 RRRRRRRRR
R11-1010 2011 4-N-Boc-2-piperazinecarboxylic acid C10H18N2O4 128019-59-0
R11-1011 2011 R-4-Boc-piperazine-2-carboxylic acid C10H18N2O4 192330-11-3
R11-1012 2011 (S)-4-N-Boc-Piperazine-2-carboxylic acid C10H18N2O4 848482-93-9
R11-1013 2011 (R)-4-Boc-Piperazine-3-carboxylic acid C10H18N2O4 278788-60-6
R11-1014 2011 (S)-4-Boc-Piperazine-3-carboxylic acid C10H18N2O4 159532-59-9
R11-1015 2011 4-Boc-Piperazine-3-carboxylic acidd C10H18N2O4 1214196-85-6
R11-1016 2011 Piperazine-2-carboxylic acid dihydrochloride C5H10N2O2 133525-05-0
R11-1017 2011 4-N-Cbz-Piperazine-2-carboxylic acid C13H16N2O4 64172-98-1
R11-1018 2011 (S)-1-N-Cbz-piperazine-2-carboxylic acid methylester C14H18N2O4 314741-63-4
R11-1019 2011 1-N-Cbz-piperazine-2-carboxylic acid methyl ester C14H18N2O4 126937-43-7
R11-102 2011 B2R (54-62) YSQVNKRYI
R11-1020 2011 N-Boc-piperazine-2-carboxylic acid methyl ester C11H20N2O4 129799-15-1
R11-1021 2011 (R)-Piperazine-2-carboxylic acid C5H10N2O2 31321-68-3
R11-1022 2011 2-Piperazinecarboxylic acid C5H10N2O2 2762-32-5
R11-1023 2011 (R)-(+)-2-Piperazinecarboxylic acid dihydrochloride C5H12Cl2N2O2 126330-90-3
R11-1024 2011 Piperazine-2-carboxylic acid methyl ester dihydrochloride C6H12N2O2.2(HCl) 122323-88-0
R11-1025 2011 (S)-4-N-Cbz-Piperazine-2-carboxylic acid methylester C14H18N2O4 225517-81-7
R11-1026 2011 (R)-4-(benzyloxycarbonyl)piperazine-2-carboxylic acid C13H16N2O4 276695-09-1
R11-1027 2011 (R)-N-Boc-piperazine-2-carboxylic acid methyl ester C11H20N2O4 252990-05-9
R11-1028 2011 (S)-N-Boc-Piperazine-2-carboxylic acid methyl ester C11H20N2O4 796096-64-5
R11-1029 2011 N-Boc-piperazine-2-carboxylic acid methyl ester C11H20N2O4 129799-15-1
R11-103 2011 B8R(20-27) TSYKFESV
R11-1030 2011 (R)-4-N-Cbz-Piperazine-2-carboxylic acid methylester C14H18N2O4 405175-79-3
R11-1031 2011 (S)-1-N-Boc-piperazine-3-carboxylic acid methyl ester C11H20N2O4 314741-39-4
R11-1032 2011 (R)-1-N-Boc-3-piperazinecarboxylic acid methyl ester C11H20N2O4 438631-77-7
R11-1033 2011 Methyl 4-Boc-piperazine-2-carboxylate C11H20N2O4 129799-08-2
R11-1034 2011 4-N-Cbz-2-Hydroxymethyl-piperazine C13H18N2O3 191739-40-9
R11-1035 2011 (R)-1-Boc-3-(hyroxymethyl)piperazine C10H20N2O3 278788-66-2
R11-1036 2011 (S)-1-Boc-3-hydroxymethylpiperazine C10H20N2O3 314741-40-7
R11-1037 2011 1-Boc-3-hydroxymethylpiperazine C10H20N2O3 301673-16-5
R11-1038 2011 4-N-Benzyl-2-Hydroxymethylpiperazine C12H18N2O 85817-34-1
R11-1039 2011 (S)-1-N-Cbz-2-methyl-piperazine C13H18N2O2 923565-98-4
R11-104 2011 Calcineurin (PP2B) Substrate DLDVPIPGRFDRRV(pS)VAAE
R11-1040 2011 (S)-1-N-Fmoc-2-methyl-piperazine C20H22N2O2 888972-50-2
R11-1041 2011 (R)-4-Boc-2-methylpiperazine C10H20N2O2 163765-44-4
R11-1042 2011 (S)-4-N-Boc-2-methylpiperazine C10H20N2O2 147081-29-6
R11-1043 2011 4-N-Boc-2-Methyl-piperazine C10H20N2O2 120737-59-9
R11-1044 2011 (R)-1-N-Boc-2-methylpiperazine C10H20N2O2 170033-47-3
R11-1045 2011 (S)-1-N-Boc-2-methylpiperazine C10H20N2O2 169447-70-5
R11-1046 2011 (R)-N-Boc-piperazine-2-carboxylic acid methyl ester C6H12N2O 60565-89-1
R11-1047 2011 4-Boc-1-Fmoc-2-piperazine acetic acid C26H30N2O6 183742-34-9
R11-1048 2011 1-tert-Butylpiperazine C8H18N2 38216-72-7
R11-1049 2011 1-Boc-piperazine C9H18N2O2 57260-71-6
R11-105 2011 CEF1, Influenza Matrix Protein M1(58-66) GILGFVFTL
R11-1050 2011 1-Piperazinecarboxylicacid, 4-phenyl-, 1,1-dimethylethyl ester C15H22N2O2 77278-63-8
R11-1051 2011 1-(3-Nitrophenyl)piperazine C10H13N3O2 54054-85-2
R11-1052 2011 1-(2-N-Boc-Aminoethyl)piperazine C11H23N3O2 140447-78-5
R11-1053 2011 4-(2-Amino-ethyl)-piperazine-1-carboxylic acid tert butyl ester C11H23N3O2 192130-34-0
R11-1054 2011 1-N-propylpiperazine dihydrobromide C7H18Br2N2 64262-23-3
R11-1055 2011 (R)-Piperazine-2-carboxylic acid dihydrochloride C5H10N2O2.2HCl 126330-90-3
R11-1056 2011 (S)-Piperazine-2-carboxylic acid dihydrochloride C5H10N2O2.2HCl 158663-69-5
R11-1057 2011 2-Piperazinecarboxylic acid, ethyl ester, dihydrochloride C7H14N2O2.2HCl 129798-91-0
R11-1058 2011 1-methyl-1H-indole-5-carboxylic acid C10H9NO2 186129-25-9
R11-1059 2011 1-Methyl-1H-indol-5-amine C9H10N2 102308-97-4
R11-106 2011 CEF4, Influenza Virus NP (342-351) RVLSFIKGTK
R11-1060 2011 Methyl 5-methylindole-3-carboxylate C11H11NO2 227960-12-5
R11-1061 2011 5-Aminoindole C8H8N2 5192-03-0
R11-1062 2011 7-Bromoindole C8H6BrN 51417-51-7
R11-1063 2011 7-Azaindole C7H6N2 271-63-6
R11-1064 2011 3-Methyl-1H-indol-1-amine C9H10N2 22259-53-6
R11-1065 2011 Ethylhexyl triazone C48H66N6O6 88122-99-0
R11-1065 2011 2-Ethylhexyl 4-[[4,6-bis[[4-(2-ethylhexoxycarbonyl)phenyl]amino]-1,3,5-triazin C48H66N6O6 88122-99-0
R11-1065 2011 Octyl triazone C48H66N6O6 88122-99-0
R11-1065 2011 2,4,6-Trianilino-P-(Carbo-2'-Ethylhexyl-1'-Oxy)-1,3,5-Triazine C48H66N6O6 88122-99-0
R11-107 2011 CEF7, Influenza Virus NP(380-388) ELRSRYWAI
R11-108 2011 CEF11, Epstein - Barr Virus BMLF1(280-288) GLCTLVAML
R11-109 2011 CEF19, Epstein - Barr Virus latent NA-3A(458-466) YPLHEQHGM
R11-110 2011 CEF20, Cytomegalovirus, CMV pp65(495-503) NLVPMVATV
R11-111 2011 CEF21, Cytomegalovirus, CMV pp65 (417-426) TPRVTGGGAM
R11-112 2011 CEF23, Cytomegalovirus, CMV pp65(123-131) IPSINVHHY
R11-113 2011 CEF24, Influenza Virus PB1 Peptide(591-599) VSDGGPNLY
R11-114 2011 CEF25, Influenza Virus NP (44 - 52) CTELKLSDY
R11-115 2011 Cell Penetrating Peptides rrrrrrrrr-NH2 (All D-form Arg)
R11-116 2011 Derived from equine infectious anaemia virus (EIAV) envelope protein (residues 195-206) RVEDVTNTAEYW
R11-117 2011 ESAT-6-derived Peptide (1-20) MTEQQWNFAGIEAAASAIQG
R11-118 2011 Exendin 4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
R11-119 2011 E75, Her - 2/ neu (369 - 377) KIFGSLAFL
R11-120 2011 Flu Nucleoprotein NP (383–391) SRYWAIRTR
R11-121 2011 F11 Receptor-Protein (D-Lys)SVT(D-Arg)EDTGTYTC
R11-122 2011 L-4F Ac-DWFKAFYDKVAEKFKEAF-NH2
R11-123 2011 D-4F
R11-124 2011 Sc-4F Ac-DWFAKDYFKKAFVEEFAK-NH2
R11-125 2011 Ghrelin (Rat) des-n-Octanoyl GSSFLSPEHQKAQQRKESKKPPAKLQPR
R11-126 2011 Glucagon 1-29 (Bovine, Human) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-NH2
R11-127 2011 GLP-1(7-36),amide,Human HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
R11-128 2011 HA peptide YPYDVPDYA
R11-129 2011 HA 12CA5 Epitope CYPYDVPDYA
R11-130 2011 HBcAg (HBV) (18-27) FLPSDFFPSV
R11-131 2011 HGH Fragment 176-191 YLRIVQCRSVEGSCGF
R11-132 2011 [Arg(Me2s)3] - Histone H4 (1-1) SG-R(me2s)-GKGGKG
R11-133 2011 HLA-B*57-QW9 QASQEVKNW
R11-134 2011 Human Papillomavirus (HPV) E7 Protein(49-57) RAHYNIVTF
R11-135 2011 HXB2 gag #36/aa147-155 ISPRTLNAW
R11-136 2011 Influenza A NP(366 - 374) Strain A/PR/8/35 ASNENMETM
R11-137 2011 Influenza A virus M2 Protein PIRNEWGCRCNDSSD
R11-138 2011 Influenza HA(518-526) IYSTVASSL
R11-139 2011 Influenza NP (147-155) TYQRTRALV
R11-140 2011 Kisspeptin - 10 (Kp-10), Metastin (110-119), Amide, Mouse, Rat YNWNSFGLRY-NH2
R11-141 2011 Lymphocytic Choreomeningitis Virus (LCMV) Glycoprotein 33 (33–41), LCMV GP1, gp33(33-41) KAVYNFATC
R11-142 2011 LCMV gp33-41 KAVYNFATM
R11-143 2011 LCMV NP396 H - 2Db Peptide FQPQNGQFI
R11-144 2011 LL 190-201 NEKYAQAYPNVS
R11-145 2011 LL-37, Antimicrobial Peptide, Human [LL-37, 37 aa]
R11-146 2011 LMP2(236-244),RRR RRRWRRLTV
R11-147 2011 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS
R11-148 2011 a-Mating Factor Pheromone, Yeast WHWLQLKPGQPMY
R11-149 2011 MBP (68-86), Myelin Basic Protein (68-86) YGSLPQKSQRSQDENPV
R11-150 2011 MOG (94-108), Rat GGYTCFFRDHSYQEE
R11-151 2011 MOG (35-55), Mouse/Rat MEVGWYRSPFSRVVHLYRNGK
R11-152 2011 c-Myc Peptide Epitope EQKLISEEDL
R11-153 2011 Cys-c-Myc Peptide Epitope CEQKLISEEDL
R11-154 2011 Myosin H Chain Fragment(615-630), Mouse Ac-SLKLMATLFSTYASAD
R11-155 2011 Myosin H Chain Fragment(614-631), Mouse Ac-RSLKLMATLFSTYASADR
R11-156 2011 NP 381-395 LRSRYWAIRTRSGGN
R11-157 2011 NY-ESO-1(81-88) Peptide RGPESRLL
R11-158 2011 NY-ESO-1(157-165) SLLMWITQC
R11-159 2011 N36, HR1, gp41 HIV Fragment Ac-SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL-NH2
R11-160 2011 Obestatin (Human, Monkey) FNAPFDVGIKLSGVQYQQHSQAL-NH2
R11-161 2011 Obestatin (Rat, Mouse) FNAPFDVGIKLSGAQYQQHGRAL-NH2
R11-162 2011 Obestatin (11-23) Human LSGVQYQQHSQAL
R11-163 2011 Obestatin (11-23) Rat, Mouse LSGAQYQQHGRAL
R11-164 2011 OVA(257-264) SIINFEKL
R11-165 2011 OVA (323-339) ISQAVHAAHAEINEAGR
R11-166 2011 PA1-984B Neutralizing Peptide DYKDDDDKC
R11-167 2011 PLP (139-151) HCLGKWLGHPDKF
R11-168 2011 [Ser140] - PLP (139-151) HSLGKWLGHPDKF
R11-169 2011 Prion Protein (106-126) KTNMKHMAGAAAAGAVVGGLG
R11-170 2011 Protease - Activated Receptor-2, PAR-2 Agonist SLIGRL-NH2
R11-171 2011 SAMS Peptide HMRSAMSGLHLVKRR
R11-172 2011 SARS-CoV, 1203–1211 FIAGLIAIV
R11-173 2011 SARS/S-derived Peptide-1 RLNEVAKNL
R11-174 2011 Smcy HY Peptide (738-746) KCSRNRQYL
R11-175 2011 Substance P RPKPQQFFGLM-NH2
R11-176 2011 TAT peptide; Cell Permeable Peptides (CPP) YGRKKRRQRRR
R11-177 2011 Tax9, HTLV-1(11-19) LLFGYPVYV
R11-178 2011 Transdermal Peptide ACSSSPSKHCG
R11-179 2011 Cys-T-7 Peptide CMASMTGGQQMG
R11-180 2011 T-7 Peptide-Cys MASMTGGQQMGC
R11-181 2011 Trp Cage NLYIQWLKDGGPSSGRPPPS
R11-182 2011 WT 126-134 RMFPNAPYL
R11-183 2011 Flag Peptide DYKDDDDK
R11-184 2011 Cys-Flag Peptide CDYKDDDDK
R11-185 2011 Flg22, Flagellin Fragment QRLSTGSRINSAKDDAAGLQIA
R11-186 2011 Triple Flag DYKDHDGDYKDHDIDYKDDDDK
R11-187 2011 3ÂFlag Peptide MDYKDHDGDYKDHDIDYKDDDDK
R11-188 2011 His Tag HHHHHH
R11-189 2011 Cys-His Tag CHHHHHH
R11-190 2011 His Tag-Cys HHHHHHC
R11-191 2011 Rhodopsin Epitope Tag TETSQVAPA
R11-192 2011 V5 Epitope Tag GKPIPNPLLGLDST
R11-193 2011 Cys-V5 Epitope Tag CGKPIPNPLLGLDST
R11-194 2011 Histone H3 (7-14) tri-methylated Lys3 AR-K(me3)-STGGK
R11-195 2011 Histone H3 (1-10) ARTKQTARKS
R11-196 2011 Histone H3 (1-10) mono-methylated Lys4 ART-K(me)-QTARKS
R11-197 2011 Histone H3 (1-10) di-methylated Lys4 ART-K(me2)-QTARKS
R11-198 2011 Histone H3 (1-10) tri-methylated Lys4 ART-K(me3)-QTARKS
R11-199 2011 Histone H3 (1-15) ARTKQTARKSTGGKA
R11-200 2011 Histone H3 (1-15) mono-methylated Lys9 ARTKQTAR-K(me)-STGGKA
R11-201 2011 Histone H3 (1-15) di-methylated Lys9 ARTKQTAR-K(me2)-STGGKA
R11-202 2011 Histone H3 (1-15) tri-methylated Lys9 ARTKQTAR-K(me3)-STGGKA
R11-203 2011 Histone H3 (1-15) di-methylated Lys4 ART-K(me2)-QTARKSTGGKA
R11-204 2011 Histone H3 (1-15) tri-methylated Lys4 ART-K(me3)-QTARKSTGGKA
R11-205 2011 Histone H3 (20-34) tri-methylated Lys8 LATKAAR-K(me3)-SAPATGG
R11-206 2011 Histone H3 (1-19) tri-methylated Lys9,Biotin labeled Biotin-ARTKQTAR-K(me3)-STGGKAPRKQ-NH2
R11-207 2011 Histone H3 (1-20) ARTKQTARKSTGGKAPRKQL
R11-208 2011 Histone H3 (1-21) ARTKQTARKSTGGKAPRKQLA
R11-209 2011 Beta-Amyloid (1-15) DAEFRHDSGYEVHHQ
R11-210 2011 Beta-Amyloid (1-14) DAEFRHDSGYEVHH
R11-211 2011 Beta-Amyloid (1-13) DAEFRHDSGYEVH
R11-212 2011 Beta-Amyloid (1-12) DAEFRHDSGYEV
R11-213 2011 Beta-Amyloid (1-11) DAEFRHDSGYE
R11-214 2011 Beta-Amyloid (1-10) DAEFRHDSGY
R11-215 2011 Beta-Amyloid (1-9) DAEFRHDSG
R11-216 2011 Beta-Amyloid (1-20) DAEFRHDSGYEVHHQKLVFF
R11-217 2011 Beta-Amyloid (1-18) DAEFRHDSGYEVHHQKLV
R11-218 2011 Beta-Amyloid (13-22) Ac-HHQKLVFFAE-NH2
R11-219 2011 Beta-Amyloid (13 - 21) Ac-HHQKLVFFA-NH2
R11-220 2011 Beta-Amyloid (25-35) GSNKGAIIGLM
R11-221 2011 [Ala6]-Beta-Amyloid (1-16) DAEFRADSGYEVHHQK
R11-222 2011 EVKM-Beta-Amyloid (1-8)-Lys(Biotin) EVKMDAEFRHDSK(Biotin)
R11-223 2011 EVKM-Beta-Amyloid (1-8) EVKMDAEFRHDS
R11-224 2011 Gly-Lys(Biotin)-Gly-Beta-Amyloid (1-16) GK(Biotin)GDAEFRHDSGYEVHHQK
R11-225 2011 Beta-Amyloid (3-15)-Lys(Biotin)-NH2 EFRHDSGYEVHHQK(Biotin)-NH2
R11-226 2011 Beta-Amyloid (1-13)-Lys(Biotin)-NH2 DAEFRHDSGYEVHK(Biotin)-NH2
R11-227 2011 Beta-Amyloid (1-10)-Lys(Biotin)-NH2 DAEFRHDSGYK(Biotin)-NH2
R11-228 2011 Beta-Amyloid (6-15)-Lys(Biotin)-NH2 HDSGYEVHHQK(Biotin)-NH2
R11-229 2011 Beta-Amyloid (4-15)-Lys(Biotin)-NH2 FRHDSGYEVHHQK(Biotin)-NH2
R11-230 2011 Beta-Amyloid (5-15)-Lys(Biotin)-NH2 RHDSGYEVHHQK(Biotin)-NH2
R11-231 2011 Beta-Amyloid (1-11)-Lys(Biotin)-NH2 DAEFRHDSGYEK(biotin)-NH2
R11-232 2011 Beta-Amyloid (1-20)-Lys(Biotin) DAEFRHDSGYEVHHQKLVFFK(Biotin)
R11-233 2011 Beta-Amyloid (1-19)-Lys(Biotin)-NH2 DAEFRHDSGYEVHHQKLVFK(Biotin)-NH2
R11-234 2011 Beta-Amyloid (1-18)-Lys(Biotin)-NH2 DAEFRHDSGYEVHHQKLVK(Biotin)-NH2
R11-235 2011 Beta-Amyloid (1-17)-Lys(Biotin)-NH2 DAEFRHDSGYEVHHQKLK(Biotin)-NH2
R11-236 2011 Beta-Amyloid (1-16)-Lys(Biotin)-NH2 DAEFRHDSGYEVHHQKK(Biotin)-NH2
R11-237 2011 Beta-Amyloid (1-15)-Lys(Biotin)-NH2 DAEFRHDSGYEVHHQK(Biotin)-NH2
R11-238 2011 Paclitaxel, Docetaxel 32981-86-5
R11-239 2011 Paclitaxel,70%
R11-240 2011 Docetaxel 196404-55-4 
R11-241 2011 Docetaxel 114915-14-9 
R11-242 2011 Oxaliplatin 10025-99-7
R11-243 2011 Oxaliplatin 20439-47-8
R11-244 2011 Ramosetron 131020-49-0
R11-245 2011 Temozomide 287964-59-4
R11-246 2011 2-Thiazolecarboxamide 16733-85-0
R11-247 2011 4-hydroxy-benzothiazol 7405-23-4
R11-248 2011 6-Ethyl-pyrimidine-2,4-diamine 514854-12-7
R11-249 2011 2-Amino-6-ethyl-pyrimidin-4-ol 5734-66-7
R11-250 2011 4-Methoxy-benzothiazol-2-ylamine 5464-79-9
R11-251 2011 3-Formyl-4-hydroxybenzonitrile 74901-29-4
R11-252 2011 4-(Formyl-methyl-amino)-benzoic acid
R11-253 2011 4-Chloro-2-iodo-1H-pyrrolo[2,3-b]pyridine 940948-29-8
R11-254 2011 2-CYANOBENZOIC ACID 3839-22-3
R11-255 2011 (3alpha,5beta,7alpha,12alpha)-7,12-Bis(formyloxy)-3-hydroxycholan-24-oic acid 64986-86-3
R11-256 2011 3a,12a-diol-7-oxo-5ß-24-cholanoic acid methyl ester, methyl 10538-65-5
R11-257 2011 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine hydrochloride 23007-85-4
R11-258 2011 3a,6a,7a,12a-tetrahydroxy-5ß-cholanoic acid 63266-88-6
R11-259 2011 1-aminooxy-2,4-dinitro-benzene 17508-17-7
R11-260 2011 5-Bromo-4-chloro-7H-pyrrolo[2,3-d]pyrimidine 22276-95-5
R11-261 2011 3a,12a-dihydroxy-7-keto-5ß-cholan-24-oic acid 911-40-0
R11-262 2011 8-[(E)-2-(3,4-dimethoxyphenyl)ethenyl]-1,3-diethyl-7-methyl-purine-2,6-dione 155270-99-8
R11-263 2011 [4-Amino-2-[(1-methylsulfonylpiperidin-4-yl)amino]pyrimidin-5-yl](2,3-difluoro-6-methoxyphenyl)methanone 741713-40-6
R11-264 2011 Thiazole Orange 107091-89-4
R11-265 2011 D-Luciferin 2591-17-5
R11-266 2011 5-Aminomethyl-2-chlorothiazole 120740-08-1
R11-267 2011 4-Methyl-1,3-thiazole-2-carbaldehyde 13750-68-0
R11-268 2011 1,3-Benzothiazole-6-sulfonyl chloride 181124-40-3
R11-269 2011 2-Amino-4-(trifluoromethyl)thiazole 349-49-5
R11-270 2011 Ethyl 4-Cyclopropylthiazole-2-carboxylate 439692-05-4
R11-271 2011 5-Boc-2-Amino-4,5,6,7-tetrahydrothiazolo[5,4-c]pyridine 365996-05-0
R11-272 2011 Ethyl 2-Bromothiazole-4-carboxylate 100367-77-9
R11-273 2011 6,7-Dihydro-4H-pyrano[4,3-d]thiazol-2-ylamine 259810-12-3
R11-274 2011 4,5,6,7-Tetrahydro-thiazolo[5,4-c]pyridin-2-ylamine 3364-78-1
R11-275 2011 4-(2-Aminoethyl)piperidine, 4-BOC protected 165528-81-4
R11-276 2011 4-amino-1-methylbutyl(6-methoxy-8-quinolyl)amine;primaquine 90-34-6
R11-277 2011 3-(Trifluoromethyl)pyridine-2-carboxylic Acid 87407-12-3
R11-278 2011 Thiazole 288-47-1
R11-279 2011 1-Boc-3-Methylaminopyrrolidine 454712-26-6
R11-280 2011 2-Amino-benzothiazol-4-ol 7471-03-6
R11-281 2011 N-Methyl-1H-Indole-5-EthaneSulphonamide 98623-50-8
R11-282 2011 5-Acetyl-8-hydroxy-1H-quinolin-2-one 62978-73-8
R11-283 2011 5-[2-Cyclopropyl-1-(2-fluorophenyl)-2-oxoethyl]-5,6,7,7a-tetrahydrothieno[3,2-c]pyridin-2(4H)-one 150322-38-6
R11-284 2011 Methyl (2S,4E)-5-chloro-2-isopropylpent-4-enoate 387353-77-7
R11-285 2011 4-Amino-2-methyl-5-pyrimidinecarboxaldehyde 73-68-7
R11-286 2011 5-Fluoropyrimidin-4-amine 811450-26-7
R11-287 2011 3-tert-Butylbenzenesulphonyl chloride 2905-26-2
R11-288 2011 3-Isopropylbenzene-1-sulphonyl chloride 71530-58-0
R11-289 2011 2-(pyridin-2-yl)-5-bromopyridine 15862-19-8
R11-290 2011 5-Acetyl-2-methylpyridine 36357-38-7
R11-291 2011 5-Formyl-2-methylpyridine 53014-84-9
R11-292 2011 methyl 4-hydroxypyrimidine-5-carboxylate 4774-35-0
R11-293 2011 5-bromo-1H,5H-pyrimidine-4,6-dione 52176-13-3
R11-294 2011 4-Boc-2-(aminomethyl)morpholine 140645-53-0
R11-295 2011 1-Methylpyrrolidine-3-carboxylate hydrochloride 198959-37-4
R11-296 2011 3-Pyrrolidinecarboxylic acid, methyl ester, (3R)- (9CI) 428518-43-8
R11-297 2011 Propionamidine hydrochloride 39800-84-5
R11-298 2011 3-Amino-3-iminopropanoic acid ethyl ester hydrochloride 57508-48-2
R11-299 2011 2-(4-benzylmorpholin-2-yl)acetic acid 146944-27-6
R11-300 2011 N-Boc-2-morpholinecarboxylic acid 189321-66-2
R11-301 2011 N-Trityl-L-serine methyl ester 4465-44-5
R11-302 2011 tert-Butyl (3R)-3-(hydroxymethyl)morpholine-4-carboxylate 215917-99-0
R11-303 2011 S)-4-Boc-morpholine-3-carboxylic Acid 783350-37-8
R11-304 2011 4-Boc-3(R)-morpholinecarboxylic acid 869681-70-9
R11-305 2011 4-cyano-3-methylbenzoic acid 73831-13-7
R11-306 2011 4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)morpholine 568577-88-8
R11-307 2011 5-Bromo-1-benzofuran 23145-07-5
R11-308 2011 2,4-Diphenylimidazole 670-83-7
R11-309 2011 2-Fluoro-5-iodophenol 186589-89-9
R11-310 2011 2-Chloro-5-iodophenol 289039-26-5
R11-311 2011 2-chloro-5-iodobenzonitrile 289039-29-8
R11-312 2011 5-BROMO-1H-INDAZOLE-3-CARBALDEHYDE 201227-38-5
R11-313 2011 6-BROMO-1H-INDAZOLE-3-CARBALDEHYDE 885271-72-7
R11-314 2011 4-NITROCINNAMALDEHYDE 1734-79-8
R11-315 2011 4-AMINO-2,3-DIFLUORO-PHENOL 163733-99-1
R11-316 2011 Phenol, 4-amino-2-chloro-3-fluoro- 1003710-18-6
R11-317 2011 1H-Benzimidazol-4-amine 4331-29-7
R11-318 2011 3-(4-FLUOROPHENYL)BENZOIC ACID 10540-39-3
R11-319 2011 4'-Fluorobiphenyl-4-carbaldehyde 60992-98-5
R11-320 2011 2-Amino-6-bromophenol 28165-50-6
R11-321 2011 4-AMINO-2,5-DIFLUOROPHENOL 120103-19-7
R11-322 2011 4-Amino-2,5-dichlorophenol 50392-39-7
R11-323 2011 5-Bromo-1-benzofuran 23145-07-5
R11-324 2011 Ethyl 2-oxohexanoate 5753-96-8
R11-325 2011 4-Bromo-3-bromomethyl anisole 19614-12-1
R11-326 2011 3-HYDROXYPROPIONIC ACID 503-66-2
R11-327 2011 1-Methyl-1H-pyrazole-5-carbaldehyde 27258-33-9
R11-328 2011 5-Bromo-2,2-difluorobenzodioxole 33070-32-5
R11-329 2011 3-(2-CHLORO-1,1,2-TRIFLUOROETHOXY)BENZALDEHYDE 2003-15-8
R11-330 2011 [4-(4-CHLOROPHENYL)PHENYL]METHYLAMINE HYDROCHLORIDE 410077-96-2
R11-331 2011 Methyl 2-bromomethylbenzoate 2417-73-4
R11-332 2011 1-Chlorocyclohexene 930-66-5
R11-333 2011 7-CHLORO-1-HEPTENE 929-21-5
R11-334 2011 6,9-Dichloro-2-methoxyacridine 86-38-4
R11-335 2011 5-BROMOINDOLINE 17422-32-1
R11-336 2011 5-BROMOOXINDOLE 39795-60-3
R11-337 2011 5-Nitroindoline 32692-19-6
R11-338 2011 6-Nitroindoline 19727-83-4
R11-339 2011 1,3-DIBROMOACETONE 816-39-7
R11-340 2011 1,3,5-Tris(bromomethyl)benzene 18226-42-1
R11-341 2011 Methyl 2-bromomethyl-3-nitrobenzoate 98475-07-1
R11-342 2011 2-Bromomethylquinoline 5632-15-5
R11-343 2011 N-Boc-1-aminocyclobutanecarboxylic acid 14804-31-0
R11-344 2011 6-Nitroindole 4769-96-4
R11-345 2011 2-(4-bromo-3-fluorophenyl)acetonitrile 499983-13-0
R11-346 2011 2-AMINO-4-FLUOROPHENOL 399-97-3
R11-347 2011 5-Bromo-1-benzofuran 23145-07-5
R11-348 2011 1-BENZOFURAN-5-CARBOXYLIC ACID 90721-27-0
R11-349 2011 2,4-Dihydroxy-5-iodobenzaldehyde 131088-03-4
R11-350 2011 3-(Boc-amino)-3-phenylpropionic acid 82954-52-7
R11-351 2011 methyl 3-amino-2-phenylpropanoate 91012-17-8
R11-352 2011 3-TERT-BUTOXYCARBONYLAMINO-2-PHENYL-PROPIONIC ACID 67098-56-0
R11-353 2011 2-Fluoro-4-nitrobenzoic acid 403-24-7
R11-354 2011 2-FLUORO-N-METHYL-4-NITROBENZAMIDE 915087-24-0
R11-355 2011 benzyl 2-amino-4-(benzyloxy)-5-methoxybenzoate 205295-41-2
R11-356 2011 2-Chloro-3-methoxyaniline 113206-03-4
R11-357 2011 Ethanone, 1-(2-amino-3-chloro-4-methoxyphenyl)- 923289-36-5
R11-358 2011 METHYL 3-METHOXY-4,5-METHYLENEDIOXYBENZOATE 22934-58-3
R11-359 2011 2-(tert-Butoxycarbonylamino)-2-phenylethanol 67341-01-9
R11-360 2011 ethyl 2-(4-aminophenyl)propanoate 32868-25-0
R11-361 2011 6-Nitro-indan-1-one 24623-24-3
R11-362 2011 6-Nitro-indan-1-ol 119273-81-3
R11-363 2011 5-Nitro-1H-indene 41734-55-8
R11-364 2011 1-Amino-6-nitro-indan-2-ol 505083-08-9
R11-365 2011 8-methoxy-1H-benzo[d]azepin-2(3H)-one 85175-85-5
R11-366 2011 8-methoxy-3-methyl-1H-benzo[d]azepin-2(3H)-one 120039-18-1
R11-367 2011 7-methoxy-3-methyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine 76208-70-3
R11-368 2011 2-BROMO-2,3-DIHYDRO-5,6-DIMETHOXY-1H-INDEN-1-ONE 309575
R11-369 2011 2-(4-bromo-2-(methylsulfonyl)phenyl)-1,3-dioxolane 773088-75-0
R11-370 2011 3-BROMO-4-METHOXYPHENYLACETIC ACID 774-81-2
R11-371 2011 3-methyl-4,5-dihydro-1H-benzo[b][1,4]diazepin-2(3H)-one 54028-76-1
R11-372 2011 4-(4-NITROPHENYL)MORPHOLINE 10389-51-2
R11-373 2011 2-Amino-isophthalonitrile 63069-52-3
R11-374 2011 3-CHLORO-THIOBENZAMIDE 2548-79-0
R11-375 2011 2,3-DICHLORO-THIOBENZAMIDE 84863-83-2
R11-376 2011 2-(4-isopropylpiperazin-1-yl)isonicotinonitrile 305381-06-0
R11-377 2011 2 6-DICHLOROPYRIDINE-3-CARBOXALDEHYDE 55304-73-9
R11-378 2011 6-HYDRAZINONICOTINIC ACID 133081-24-0
R11-379 2011 tert-butyl 6-hydrazinylnicotinate 163213-19-2
R11-380 2011 2-chloro-5-(trifluoromethyl)-4-iodopyridine 505084-55-9
R11-381 2011 2-Aminopyridine-3-carboxamide 13438-65-8
R11-382 2011 N-BOC-2-AMINOMETHYLPYRIDINE 134807-28-6
R11-383 2011 N-BOC-3-AMINOMETHYLPYRIDINE 102297-41-6
R11-384 2011 2,6-Dibromopyridin-3-amine 38956-57-0
R11-385 2011 4-Amino-2-chloro-3-nitropyridine 2789-25-5
R11-386 2011 2-Chloro-3,4-diaminopyridine 39217-08-8
R11-387 2011 tert-butyl 1-(3-aminopyridin-4-yl)piperidin-3-ylcarbamate 1023298-99-8
R11-388 2011 1-(3-Chloro-2-pyridyl)piperazine 87394-55-6
R11-389 2011 2-[5-(Chloromethyl)-1,2,4-oxadiazol-3-yl]pyridine 90002-06-5
R11-390 2011 2-Bromo-5-nitro-3-(trifluoromethyl)pyridine 956104-42-0
R11-391 2011 5-nitro-3-(trifluoromethyl)picolinonitrile 573762-57-9
R11-392 2011 5-BROMOPYRIDINE-2-CARBOXYLIC ACID METHYL ESTER 29682-15-3
R11-393 2011 2-Hydroxymethyl-5-bromopyridine 88139-91-7
R11-394 2011 Methyl 6-(hydroxymethyl)nicotinate 56026-36-9
R11-395 2011 5-BROMO-2,3-DIAMINOPYRIDINE 999160
R11-396 2011 2-Chloro-5-nitronicotinic acid 29898-23-5
R11-397 2011 2-Hydroxy-5-nitronicotinic acid 1809599
R11-398 2011 2-Hydroxy-5-nitronicotinic acid 136590-83-5
R11-399 2011 6,7-Dihydro-5H-pyrrolo[3,4-b]pyridine 147739-88-6
R11-400 2011 4-CHLORO-PYRIMIDINE-5-CARBOXYLIC ACID ETHYL ESTER 41103-17-7
R11-401 2011 2-Cyclopropylpyrimidine-4-carbaldehyde 948549-81-3
R11-402 2011 ethyl 2,4-dichloropyrimidine-5-carboxylate 51940-64-8
R11-403 2011 5-AMINO-PYRAZINE-2-CARBOXYLIC ACID 40155-43-9
R11-404 2011 5-BROMOPYRIMIDINE-2-CARBOXYLIC ACID 37131-87-6
R11-405 2011 4-Hydroxy-6-methylpyrimidine 3524-87-6
R11-406 2011 4-Hydroxy-6-methylpyrimidine 54013-06-8
R11-407 2011 4-(Dimethoxymethyl)-2-(methylthio)-pyrimidine 180869-36-7
R11-408 2011 2-Methylsulfanylpyrimidine-4-carbaldehyde 1074-68-6
R11-409 2011 2-Amino-6-isopropyl-4-pyrimidinol 73576-32-6
R11-410 2011 2-Amino-4-chloro-6-isopropylpyrimidine 73576-33-7
R11-411 2011 2-AMINO-4-HYDROXY-6-ISOPROPYLPYRIMIDINE 5734-66-7
R11-412 2011 4-CHLORO-6-ETHYL-2-PYRIMIDINAMINE 5734-67-8
R11-413 2011 1-(4-methoxyphenyl)-1,6-dihydropyrazin-2-amine 1022128-78-4
R11-414 2011 ETHYL 3-CHLOROQUINOXALINE-2-CARBOXYLATE 49679-45-0
R11-415 2011 Quinoxaline-2-carboxylic acid 879-52-2
R11-416 2011 N-(5-Bromopyrazin-2-yl)-2-amino-4-methoxyaniline 950845-96-2
R11-417 2011 2,5-Dichloropyrazine 19745-07-4
R11-418 2011 6-AMINO-PYRIDAZINE-3-CARBOXYLIC ACID 59772-58-6
R11-419 2011 1-(6-Pyridazinyl)piperazine 51047-56-4
R11-420 2011 Prucalopride ????4-amino-5-chloro-2,3-dihydro-N-[1-(3-methoxypropyl)-4-piperidinyl]-7-Benzofurancarboxamide 179474-81-8
R11-421 2011 9-Hydroxyxanthene 90-46-0
R11-422 2011 3-(methylthio)-5-phenyl-1,2,4-triazine 28735-27-5
R11-423 2011 ISOQUINOLINE-5-CARBOXYLIC ACID 27810-64-6
R11-424 2011 Methyl 6-quinolineacetate 5622-36-6
R11-425 2011 6-BROMO-4-HYDROXYQUINOLINE 145369-94-4
R11-426 2011 ethyl 4-hydroxyquinoline-6-carboxylate 148018-33-1
R11-427 2011 4-CHLORO-3-METHYLQUINOLINE 63136-60-7
R11-428 2011 4-hydroxy-3-methylquinoline-2-carboxylic acid 858488-66-1
R11-429 2011 2-methylpyrido[4,3-d]pyrimidin-4(3H)-one 16952-45-7
R11-430 2011 4-HYDROXY-[1,5]NAPHTHYRIDINE-3-CARBOXYLIC ACID ETHYL ESTER 13801-51-9
R11-431 2011 7-Chloroquinazolin-4(3H)-one 31374-18-2
R11-432 2011 6-Nitro-7-Chloro-4-HydroxyQuinazoline 53449-14-2
R11-433 2011 2-AMINO-6-METHYL-4(3H)-QUINAZOLONE 50440-82-9
R11-434 2011 2,4-dioxo-1,2,3,4-tetrahydroquinazoline-8-carbonitrile 1150617-69-8
R11-435 2011 3-(Piperidin-4-yl)-3,4-dihydroquinazolin-2(1H)-one 79098-75-2
R11-436 2011 6,7-Dihydro-5H-quinolin-8-one 56826-69-8
R11-437 2011 4,6-DICHLORO-1H-PYRAZOLO[3,4-D]PYRIMIDINE 42754-96-1
R11-438 2011 6-ethoxyquinazolin-4(3H)-one 155960-97-7
R11-439 2011 5-FLUORO-8-QUINOLINAMINE 161038-18-2
R11-440 2011 N-methyl-1-thiophen-2-ylmethanamine hydrochloride 7404-67-3
R11-441 2011 3-(2-THIENYL)ACRYLIC ACID 1124-65-8
R11-442 2011 2-Bromo-5-nitrothiazole 3034-48-8
R11-443 2011 4-Chlorothieno[3,2-c]pyridine 27685-94-5
R11-444 2011 2-Amino-4,5,6,7-tetrahydro-benzothiazole-4-carboxylic acid ethyl ester 76263-11-1
R11-445 2011 4-Chlorothiazole-5-carboxaldehyde 104146-17-0
R11-446 2011 4-Amino-1-methyl-1H-imidazole-5-carboxylic acid ethyl ester 61982-18-1
R11-447 2011 5-Acetyl-1-methylpyrazole 137890-05-2
R11-448 2011 3-(1-IMidazolyl)benzoic Acid 108035-47-8
R11-449 2011 4-(1H-Pyrazol-1-yl)aniline 17635-45-9
R11-450 2011 4-Pyrazol-1-yl-benzaldehyde 99662-34-7
R11-451 2011 1-Methyl-1H-imidazole-2-carboxylic acid 20485-43-2
R11-452 2011 5-amino-3-(cyanomethyl)-1H-pyrazole-4-carbonitrile 54711-21-6
R11-453 2011 3-(4-nitrophenyl)-1H-pyrazole 20583-31-7
R11-454 2011 4-(1H-pyrazol-3-yl)aniline 89260-45-7
R11-455 2011 3-(3-nitrophenyl)-1H-pyrazole 59843-77-5
R11-456 2011 3-(1H-pyrazol-5-yl)aniline 89260-46-8
R11-457 2011 3-(4-CARBOXYPHENYL)PYRAZOLE 208511-67-5
R11-458 2011 4-(2H-Pyrazol-3-yl)-phenol 68535-53-5
R11-459 2011 3-(2H-Pyrazol-3-yl)-phenol 904665-39-0
R11-460 2011 3-(3-Carboxyphenyl)-1H-pyrazole 850375-11-0
R11-461 2011 1-Phenyl-1H-pyrazole-4-carboxylic acid 1134-50-5
R11-462 2011 5-chloro-2,3-diphenyl-1H-indole 52598-02-4
R11-463 2011 2-Pyridinecarboximidoyl chloride, N-hydroxy- 69716-28-5
R11-464 2011 6-Methoxy-1,2,3,4-tetrahydro-9H-pyrido[3,4-b]indole 20315-68-8
R11-465 2011 1-Bromo-3,5-diphenylbenzene 103068-20-8
R11-466 2011 2-Methyl-1H-imidazole-4-carboxylic acid 1457-58-5
R11-467 2011 1-(2-Chloro-5-fluoropyridin-3-yl)ethanone 1203499-12-0
R11-468 2011 2-Chloro-5-fluoronicotinic acid 38186-88-8
R11-469 2011 isoquinolin-5-ylboronic acid 371766-08-4
R11-470 2011 3-Methylthiophene-2-boronic acid 177735-09-0
R11-471 2011 isoquinolin-5-ylboronic acid 371766-08-4
R11-472 2011 N-Boc-2-pyrroleboronic acid 135884-31-0
R11-473 2011 2-(trimethylsilyl)phenyl trifluoromethanesulfonate 88284-48-4
R11-474 2011 tert-butyl 2-oxospiro[indoline-3.4-piperidine]-1-carboxylate 252882-60-3
R11-475 2011 Spiro[1H-indene-1,4'-piperidine]-1',3-dicarboxylic acid 185526-32-3
R11-476 2011 (R)-(-)-Modafinil Acid; 2-[(R)-(Diphenyl-methyl)sulfinyl]-acetic Acid 112111-45-2
R11-477 2011 tert-butyl 4-(4-iodo-1H-pyrazol-1-yl)piperidine-1-carboxylate 877399-73-0
R11-478 2011 3-[[4-(Acetylamino)-3-Ethoxyphenyl]Amino]-2-Cyano-2-Propenoic Acid Ethyl Ester 848133-74-4
R11-479 2011 n-(4-Chloro-3-cyano-7-ethoxy-6-quinolinyl) acetamide 848133-76-6
R11-480 2011 4-bromo-1-iodo-2-nitrobenzene 112671-42-8
R11-481 2011 ethyl 5-oxo-5H-thiazolo[3,2-a]pyriMidine-6-carboxylate 32278-52-7
R11-482 2011 tert-butyl 2-cyano-7-azaspiro[3.5]nonane-7-carboxylate 203662-66-2
R11-483 2011 4,4-difluorocyclohexanone 22515-18-0
R11-484 2011 2-Cyano-6-methoxybenzothiazole 943-03-3
R11-485 2011 6-methoxybenzo[d]thiazole-2-carboxylic acid 946-13-4
R11-486 2011 3-methyl-1H-indazol-6-amine 79173-62-9
R11-487 2011 3-Methyl-6-nitroindazole 6494-19-5
R11-488 2011 4-bromo-6-chloro-8-methoxyquinoline 1189107-33-2
R11-489 2011 7-bromo-5-chlorobenzofuran 286836-07-5
R11-490 2011 4-bromo-7-chloroisoquinoline 953421-72-2
R11-491 2011 ethyl 1-methyl-1H-pyrazole-5-carboxylate 14282-76-9
R11-492 2011 2-aminopyrimidin-5-ylboronic acid 936250-22-5
R11-493 2011 ethyl 4-amino-2-(methylthio)pyrimidine-5-carboxylate 776-53-4
R11-494 2011 quinoxaline-6-carboxylic acid 6925-00-4
R11-495 2011 IMIDAZO[1,2-A]PYRIDIN-2-YLMETHANOL 82090-52-6
R11-496 2011 2-CHLORO-4-(TRIFLUOROMETHYL)THIAZOLE-5-CARBOXYLIC ACID 72850-61-4
R11-497 2011 tert-Butyl 4-(hydrazinocarbonyl)piperidine-1-carboxylate 187834-88-4
R11-498 2011 2-Amino-6-methoxybenzoic acid 53600-33-2
R11-499 2011 3-chloro-1-benzothiophene-2-carbaldehyde 14006-54-3
R11-500 2011 1,3-Thiazole-2-carbaldehyde 10200-59-6
R11-501 2011 (1,2,3-Thiadiazol-5-yl)methanol 120277-87-4
R11-502 2011 3-(2-Methoxyphenyl)-5-methyl-2,3-dihydroisoxazole-4-carboxylic acid 93041-44-2
R11-503 2011 4-METHYL-2-[4-(TRIFLUOROMETHYL)PHENYL]THIAZOLE-5-CARBOXYLIC ACID 144059-86-9
R11-504 2011 5-Bromobenzoxazole 132244-31-6
R11-505 2011 6-Methoxy-1,2,3,4-tetrahydroisoquinoline hydrochloride 57196-62-0
R11-506 2011 1,2,3,4-TETRAHYDROISOQUINOLINE-6-CARBONITRILE HYDROCHLORIDE 171084-93-8
R11-507 2011 5,6,7,8-Tetrahydroquinolin-8-ol 14631-46-0
R11-508 2011 5,6,7,8-TETRAHYDROQUINOLIN-8-AMINE 298181-83-6
R11-509 2011 5-ACETYL-2-METHOXYPYRIDINE 213193-32-9
R11-510 2011 2-FLUORO-4-IODONICOTINIC ACID 884494-51-3
R11-511 2011 2-Chloro-3-bromo-5-aminopyridine 130284-53-6
R11-512 2011 11-(piperazin-1-yl)dibenzo[b,f][1,4]thiazepine dihydrochloride 111974-74-7
R11-513 2011 (6S)-6-(propyl-(2-thiophen-2-ylethyl)amino)tetralin-1-ol hydrochloride 125572-93-2
R11-514 2011 4-AMINO-5-BROMO-3-METHYLPYRIDINE 97944-43-9
R11-515 2011 3-Amino-5-bromopyridine 13535-01-8
R11-516 2011 2-Amino-3-iodo-6-methylpyridine 884495-19-6
R11-517 2011 3-BROMO-2-CHLORO-5-FLUOROPYRIDINE 884494-36-4
R11-518 2011 4,4-DIMETHYL-2-CYCLOHEXEN-1-ONE 1073-13-8
R11-519 2011 2-FLUORO-3-(TRIFLUOROMETHYL)BENZALDEHYDE 112641-20-0
R11-520 2011 5-Bromo-2-chlorobenzonitrile 57381-44-9
R11-521 2011 3-FLUORO-2-METHOXYBENZALDEHYDE 74266-68-5
R11-522 2011 (2-Aminophenyl)boronic acid hydrochloride 863753-30-4
R11-523 2011 2-(2-Aminophenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane 191171-55-8
R11-524 2011 5-Acetyl-2-thiopheneboronic acid 206551-43-1
R11-525 2011 BENZOPYRAZINE-6-BORONIC ACID HCL 852362-25-5
R11-526 2011 6-Bromo-5-methylpyridine-3-boronic acid 1003043-34-2
R11-527 2011 2-BROMO-5-(4,4,5,5-TETRAMETHYL-1,3,2-DIOXABOROLAN-2-YL)PYRIDINE 214360-62-0
R11-528 2011 4-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)benzoicacid 180516-87-4
R11-529 2011 3-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)benzoic acid 269409-73-6
R11-530 2011 2-CHLORO-3-FLUOROPYRIDINE-4-BORONIC ACID 937595-71-6
R11-531 2011 6-chloro-5-fluoropyridin-3-yl-3-ylboronic acid 1072946-66-7
R11-532 2011 (R)-2-Methyl-pyrrolidine 41720-98-3
R11-533 2011 (S)-3-NITROPHENETHYLAMINE HCL 297730-25-7
R11-534 2011 (R)-3-NITROPHENETHYLAMINE HCL 297730-27-9
R11-535 2011 3-Amino piperidine C5H12N2 54012-73-6
R11-536 2011 3-Aminopiperidine dihydrochloride C5H14Cl2N2 138060-07-8
R11-537 2011 (S)-3-Aminopiperidine dihydrochloride C5H14Cl2N2 334618-07-4
R11-538 2011 (R)-3-Aminopiperidine dihydrochloride C5H14Cl2N2 334618-23-4
R11-539 2011 (R)-3-Aminopiperidine C5H12N2 127294-73-9
R11-540 2011 (S)-3-Amino-1-benzylpiperidine C12H18N2 168466-85-1
R11-541 2011 (R)-3-Amino-1-benzylpiperidine C12H18N2 168466-84-0
R11-542 2011 1-Benzyl-3-aminopiperidine C12H18N2 60407-35-4
R11-543 2011 (R)-1-Benzyl-3-N-Boc-aminopiperidine C17H26N2O2 216854-24-9
R11-544 2011 (S)-3-Amino-1-Cbz-piperidine C13H18N2O2 876461-55-1
R11-545 2011 (R)-1-Cbz-3-aminopiperidine C13H18N2O2 1044560-96-4
R11-546 2011 (S)-1-Cbz-3-N-Boc-aminopiperidine C18H26N2O4 876379-22-5
R11-547 2011 (R)-3-N-Boc-AMINO-1-Cbz-PIPERIDINE C18H26N2O4 485820-12-0
R11-548 2011 (S)-3-Amino-1-N-Boc-piperidine C10H20N2O2 625471-18-3
R11-549 2011 (R)-1-Boc-3-Aminopiperidine C10H20N2O2 188111-79-7
R11-550 2011 N-Boc-3-Aminopiperidine C10H20N2O2 184637-48-7
R11-551 2011 (S)-1-Boc-3-(Cbz-amino)-piperidine C18H26N2O4 1002360-09-9
R11-552 2011 (S)-3-N-Boc-aminopiperidine C10H20N2O2 216854-23-8
R11-553 2011 (R)-3-(Boc-Amino)piperidine C10H20N2O2 309956-78-3
R11-554 2011 3-(Boc-Amino)piperidine C10H20N2O2 172603-05-3
R11-555 2011 (S)-3-Aminopiperidine-2-one C5H10N2O 34294-79-6
R11-556 2011 3-amino-2-Piperidinone C5H10N2O 1892-22-4
R11-557 2011 (S)-tert-butyl2-oxopiperidin-3-ylcarbamate C10H18N2O3 92235-39-7
R11-558 2011 (S)-3-N-Cbz-AMINO-PIPERIDINE C13H18N2O2 478646-33-2
R11-559 2011 (R)-3-N-Cbz-aminopiperidine C13H18N2O2 478646-32-1
R11-560 2011 (S)-1-Benzyl-3-N-Boc-aminopiperidine C17H26N2O2 454713-13-4
R11-561 2011 3-N-Cbz-3-piperidine-propionic acid C12H14N2 372144-12-2
R11-562 2011 3-N-Cbz-amino-3-(3'-Boc)piperidine-propionic acid C21H30N2O6 372144-13-3
R11-563 2011 3-N-Fmoc-amino-3-(3'-Cbz)piperidine-propionic acid C31H32N2O6 886362-38-5
R11-564 2011 3-Boc-amino-3-(2'-Cbz)piperidinepropionic acid C21H30N2O6 886362-34-1
R11-565 2011 3-Boc-amino-3-(2'-Cbz)piperidinepropionic acid C13H24N2O4 886362-32-9
R11-566 2011 3-N-Boc-amino-3-(4'-Cbz)piperidine-propionic acid C21H30N2O6 886362-33-0
R11-567 2011 3-N-Fmoc-amino-piperidine hydrochloride C20H23ClN2O2 672310-13-3
R11-568 2011 3-N-Fmoc-amino-piperidine hydrochloride C11H22N2O2 140645-24-5
R11-569 2011 (R)-N-Boc-3-aminomethylpiperidine C11H22N2O2 140645-23-4
R11-570 2011 (R)-N-Boc-3-aminomethylpiperidine C11H22N2O2 162167-97-7
R11-571 2011 (S)-3-N-Boc-Aminomethylpiperidine C11H22N2O2 1016167-99-9
R11-572 2011 (R)-3-N-Boc-Aminomethylpiperidine C11H22N2O2 879275-33-9
R11-573 2011 3-N-Boc-Aminomethylpiperidine C11H22N2O2 142643-29-6
R11-574 2011 (S)-3-N-Boc-Aminomethylpiperidine.HCL C11H23N2O2Cl 1217805-12-3
R11-575 2011 (S)-3-N-Boc-Aminomethylpiperidine.HCL C11H23N2O2Cl 1217778-64-7
R11-576 2011 3-N-Boc-Aminomethylpiperidine.HCL C11H23N2O2Cl 1159826-67-1
R11-577 2011 S-N-Boc-3-methylamino piperidine C11H22N2O2 912368-73-1
R11-578 2011 R-N-Boc-3-methylamino piperidine C11H22N2O2 203941-94-0
R11-579 2011 N-Boc-3-methylamino piperidine C11H22N2O2 392331-89-4
R11-580 2011 (R)-3-N-Boc-3-(methylamino)piperidine C11H22N2O2 309962-67-2
R11-581 2011 3-Aminomethyl-1-N-Fmoc-piperidine hydrochloride C21H25ClN2O2 669713-56-8
R11-582 2011 (S)-1-Boc-3-hydroxypiperidine C10H19NO3 143900-44-1
R11-583 2011 (R)-1-Boc-3-hydroxypiperidine C10H19NO3 143900-43-0
R11-584 2011 1-Boc-3-hydroxypiperidine C10H19NO3 85275-45-2
R11-585 2011 (S)-3-Hydroxypiperidine hydrochloride C5H12ClNO 475058-41-4
R11-586 2011 (R)-3-Hydroxypiperidine hydrochloride C5H12ClNO 198976-43-1
R11-587 2011 tert-Butyl 3-(N-Hydroxycarbamimidoyl)piperidine-1-carboxylate C11H21N3O3 479080-28-9
R11-588 2011 N-Cbz-3-hydroxypiperidine C13H17NO3 95798-22-4
R11-589 2011 1-Benzyl-3-piperidinol C12H17NO 14813-01-5 
R11-590 2011 (R)-1-Fmoc-piperidine-3-carboxylic acid C21H21NO4 193693-67-3
R11-591 2011 L-1-Fmoc-Nipecotic acid C21H21NO4 193693-68-4
R11-592 2011 (S)-(+)-3-Piperidinecarboxylic Acid C6H11NO2 59045-82-8
R11-593 2011 (R)-(-)-Nipecotic acid C6H11NO2 25137-00-2
R11-594 2011 3-Piperidinecarboxylic acid C6H11NO2 498-95-3
R11-595 2011 1-[(Benzyloxy)carbonyl]-3-piperidinecarboxylic acid C14H17NO4 78190-11-1
R11-596 2011 D-1-Cbz-Nipecotic Acid C14H17NO4 160706-62-7
R11-597 2011 (S)-1-Cbz-piperidine-3-carboxylic acid C14H17NO4 88466-74-4
R11-598 2011 (R)-Boc-Nipecotic acid C11H19NO4 163438-09-3
R11-599 2011 (S)-1-Boc-Nipecotic acid C11H19NO4 88495-54-9
R11-600 2011 1-Boc-3-piperidinecarboxylic acid C11H19NO4 84358-12-3
R11-601 2011 Ethyl 1-Boc-3-piperidinecarboxylate C13H23NO4 130250-54-3
R11-602 2011 (R)-ethyl nipecotate hydrochloride C8H16ClNO2 37675-19-7
R11-603 2011 3-Piperidinecarboxylic acid, 4-hydroxy-1-(phenylmethyl)-, ethyl ester C15H21NO3 956010-25-6
R11-604 2011 3-Carbethoxy-4-piperidone hydrochloride C8H13NO3.ClH 4644-61-5
R11-605 2011 N-Boc-piperidine-3-methanol C11H21NO3 116574-71-1
R11-606 2011 (R)-1-Boc-3-(hyroxymethyl)piperidine C11H21NO3 140695-85-8
R11-607 2011 (S)-N-Boc-piperdine-3-hydroxymethyl C11H21NO3 140695-84-7
R11-608 2011 benzyl 3-(hydroxymethyl)piperidine-1-carboxylate C14H19NO3 39945-51-2
R11-609 2011 3-Piperidinemethanol,(3R)- C6H13NO 37675-20-0
R11-610 2011 (S)-piperidin-3-yl)methanol C6H13NO 144539-77-5
R11-611 2011 3-Piperidinecarbonitrile, 4-oxo- C6H8N2O 19166-75-7
R11-612 2011 3-Piperidinecarbonitrile, 4-oxo- Hcl C6H8N2O.Hcl 1373253-28-1
R11-613 2011 3-Cyano-1-N-Fmoc-piperidine C21H20N2O2 886362-86-3
R11-614 2011 N-Boc-3-Cyanopiperidine C11H18N2O2 91419-53-3
R11-615 2011 1-N-Boc-3-(R)-cyanopiperidine C11H18N2O2 915226-44-7
R11-616 2011 (S)-1-N-Boc-3-cyanopiperidine C11H18N2O2 915226-39-0
R11-617 2011 N-Boc-3-piperidineacetic acid C12H21NO4 183483-09-2
R11-618 2011 (S)-2-(1-(tert-butoxycarbonyl)piperidin-3-yl)acetic acid C12H21NO4 941289-27-6
R11-619 2011 1-Cbz-3-Piperidineacetic Acid C15H19NO4 86827-10-3
R11-620 2011 3-Piperidine acetic acid hydrochloride C7H14ClNO2 71985-81-4
R11-621 2011 1-N-Boc-piperidine-3-ethanol C7H14ClNO2 146667-84-7
R11-622 2011 3-Piperidin-4-ylbenzonitrile C12H14N2 370864-72-5
R11-623 2011 1-Piperidinecarboxylic acid, 3-(2-pyrimidinyl)-, 1,1-dimethylethyl ester C14H21N3O2 182416-13-3
R11-624 2011 1-Boc-3-piperidinecarboxamide C11H20N2O3 91419-49-7
R11-625 2011 Piperidine-3-carboxamide C6H12N2O 4138-26-5
R11-626 2011 1-Cbz-3-piperidinecarboxamide C14H18N2O3 569348-14-7
R11-627 2011 1-Boc-Piperidin-3-ylpropionic acid C13H23NO4 352004-58-1
R11-628 2011 (S)-3-phenylpiperidine C11H15N 59349-71-2
R11-629 2011 (S)-3-(3-Methoxyphenyl)piperidine C12H17NO 88784-37-6
R11-630 2011 4-(3-Bromo-phenyl)-piperidine-1-carboxylic acid tert-butyl ester C16H22BrNO2 886362-62-5
R11-631 2011 4-(3-Carboxyphenyl)piperidine C12H15NO2 766508-67-2
R11-632 2011 3-(Piperidin-4-yl)aniline hydrochloride C11H17ClNO2 721958-70-9
R11-633 2011 Ethyl 1-N-Boc-3-oxopiperidine-4-carboxylate C13H21NO5 71233-25-5
R11-634 2011 1-Boc-3-Methanesulfonyloxymethyl-piperidine C12H23NO5S 162166-99-6
R11-635 2011 D(+)-Pipecolinic acid C6H11NO2 1723-00-8
R11-636 2011 L(-)-Pipecolinic acid C6H11NO2 3105-95-1
R11-637 2011 (S)-1-Boc-piperidine-2-carboxylic acid C11H19NO4 26250-84-0
R11-638 2011 (R)-N-Boc-2-piperidinecarboxylic acid C11H19NO4 28697-17-8
R11-639 2011 N-Boc-2-piperidinecarboxylic acid C11H19NO4 98303-20-9
R11-640 2011 (S)-1-N-Cbz-Pipecolinic acid C14H17NO4 28697-11-2
R11-641 2011 N-Cbz-Piperidine-2-carboxylic acid C14H17NO4 71170-88-2
R11-642 2011 (2R,4R)-4-Methylpiperidine-2-carboxylic acid C7H13NO2 74892-81-2
R11-643 2011 (R)-Piperidine-2-carboxylic acid methyl ester hydrochloride C7H13NO2.HCl 18650-38-9
R11-644 2011 N-Boc-2- Piperidine Methanol C11H21NO3 157634-00-9
R11-645 2011 (R)-N-Boc-piperidine-2-methanol C11H21NO3 134441-61-5
R11-646 2011 (S)-N-Boc-piperidine-2-methanol C11H21NO3 134441-93-3
R11-647 2011 (S)-1-N-Boc-piperidine-2-ethanol C12H23NO3 199942-74-0
R11-648 2011 (R)-1-N-Boc-piperidine-2-ethanol C12H23NO3 250249-85-5
R11-649 2011 1-N-Fmoc-2-Cyanopiperid C21H20N2O2 672310-10-0
R11-650 2011 (S)-1-Boc-2-cyanopiperidine C11H18N2O2 228244-04-0
R11-651 2011 (R)-1-Boc-2-cyanopiperidine C11H18N2O2 242459-44-5
R11-652 2011 N-Boc-2-Cyanopiperidine C11H18N2O2 153749-89-4
R11-653 2011 N-Cbz-2-cyanopiperidine C14H16N2O2 1017788-63-4
R11-654 2011 1-Boc-2-(Aminomethyl)piperidine C11H22N2O2 370069-31-3
R11-655 2011 2-Aminomethyl-1-N-Cbz-piperidine C14H20N2O2 811842-18-9
R11-656 2011 2-(Boc-aminomethyl)-piperidine C11H22N2O2 141774-61-0
R11-657 2011 2-Aminomethyl-1-N-Fmoc-piperidine hydrochloride C21H25CIN2O2 669713-55-7
R11-658 2011 2-N-Fmoc-aminomethyl piperidine C21H24N2O2 672310-15-5
R11-659 2011 (S)-Piperidinone-6-carboxylic acid C6H9NO3 34622-39-4
R11-660 2011 (S)-2-Carbamoyl-piperidine-1-carboxylic acid benzyl ester C14H18N2O3 61703-39-7
R11-661 2011 1-N-Boc-Piperidine-2-carboxamide C11H20N2O3 388077-74-5
R11-662 2011 N-Boc-D-2-piperidinecarboxamide C11H20N2O3 848488-91-5
R11-663 2011 2-(2-Carboxyethyl)piperidine-1-carboxylic acid tert-butyl ester C13H23NO4 669713-96-6
R11-664 2011 (S)-2-Aminomethyl-1-N-Boc-Piperidine C11H22N2O2 475105-35-2
R11-665 2011 4-Phenyl-2-pyrrolidin-1-ylmethyl-piperidine C16H24N2 885951-15-5
R11-666 2011 4-(3-Methylphenyl)piperidine C12H17N 111153-83-4
R11-667 2011 4-(4'-Cyanophenyl)piperidine C12H14N2 149554-06-3
R11-668 2011 4-Piperidin-4-ylbenzonitrile C12H14N2 162997-34-4
R11-669 2011 4-(3-Fluoro-phenyl)-piperidine C11H14FN 104774-88-1
R11-670 2011 4-(2-Boc-aminoethyl)piperidine C12H24N2O2 165528-81-4
R11-671 2011 N-Boc-4-piperidinemethanol C11H21NO3 123855-51-6
R11-672 2011 1-Cbz-4-hydroxymethylpiperidine C14H19NO3 122860-33-7
R11-673 2011 4-(4'-N-Methylbenzamide)piperidine C13H18N2O 161610-09-9
R11-674 2011 1-N-Boc-4-N-Fmoc-amino-4-carboxylic-piperidine C26H30N2O6 183673-66-7
R11-675 2011 tert-Butyl 4-(bromomethyl)piperidine-1-carboxylate C11H20BrNO2 158407-04-6
R11-676 2011 1-Boc-4-(aminomethyl)piperidine C11H22N2O2 144222-22-0
R11-677 2011 1-Cbz-4-Aminomethylpiperidine C14H20N2O2 157023-34-2
R11-678 2011 1-N-Cbz-4-N-(Boc-aminomethyl)piperidine C19H28N2O4 172348-56-0
R11-679 2011 1-Fmoc-4 -(Aminomethyl)Piperidine hydrochloride C21H25ClN2O2 391248-14-9
R11-680 2011 4-(Boc-Aminomethyl)piperidine C11H22N2O2 135632-53-0
R11-681 2011 Carbamic acid,N-(4-piperidinylmethyl)-, phenylmethyl ester C14H20N2O2 132431-09-5
R11-682 2011 1-Boc-piperidin-4-ylideneacetic acid C12H19NO4 193085-24-4
R11-683 2011 4-Piperidine acetic acid hydrochloride C7H13NO2HCl 73415-84-6
R11-684 2011 4-Piperidinylacetic acid C7H13NO2 51052-78-9
R11-685 2011 1-Boc-4-piperidylacetic acid C12H21NO4 157688-46-5
R11-686 2011 N-Cbz-4-piperidineacetic acid C15H19NO4 63845-28-3
R11-687 2011 4-Piperidineacetic acid, 1-acetyl- C9H15NO3 78056-60-7
R11-688 2011 1-N-Cbz-4-Methoxycarbonylmethyl-piperidine C16H21NO4 170737-53-8
R11-689 2011 Methyl 4-piperidineacetate C8H15NO2 168986-49-0
R11-690 2011 Methyl (4-piperidyl)acetate hydrochloride C9H17NO2Hcl 81270-37-3
R11-691 2011 Ethyl 2-piperidin-4-ylacetate C9H17NO2 59184-90-6
R11-692 2011 Ethyl N-Cbz-4-piperidineacetate C17H23NO4 80221-26-7
R11-693 2011 4-Piperidinecarboxylic acid C6H11NO2 498-94-2
R11-694 2011 1-[(Benzyloxy)carbonyl]piperidine-4-carboxylic acid C14H17NO4 10314-98-4
R11-695 2011 N-Boc-piperidine-4-carboxylic acid C11H19NO4 84358-13-4
R11-696 2011 1-Isopropylpiperidine-4-carboxylic acid C9H17NO2 280771-97-3
R11-697 2011 1-Acetyl-4-piperidinecarboxylic acid C8H13NO3 25503-90-6
R11-698 2011 1-methyl-piperidine-4-carboxylic acid C7H13NO2 68947-43-3
R11-699 2011 1-(benzyloxycarbonyl)-4-(tert-butoxycarbonyl)piperidine-4-carboxylic acid C19H26N2O6 252720-32-4
R11-700 2011 (1-N-Cbz-piperidin-4-yloxy)acetic acid C15H19NO5 138163-07-2
R11-701 2011 4-(Boc-Aminomethyl)piperidine C11H22N2O2 135632-53-0
R11-702 2011 4-(4'-Carboxyphenyl)piperidine C12H15NO2 196204-01-0
R11-703 2011 1-Boc-4-methanesulfonyloxypiperidine C11H21NO5S 141699-59-4
R11-704 2011 4-(Methanesulfonyloxymethyl)-piperidine-1-carboxylic acid benzyl ester C15H21NO5S 159275-16-8
R11-705 2011 1-Cyclopropylpiperidin-4-one C8H13NO 62813-01-8
R11-706 2011 1-Cbz-4-Piperidone C15H13NO5 19099-93-5
R11-707 2011 N-(tert-Butoxycarbonyl)-4-piperidone C10H17NO3 79099-07-3
R11-708 2011 4-Piperidone hydrochloride hydrate C5H12ClNO2 320589-77-3
R11-709 2011 4-(3-Fluorophenyl)-piperidine hydrochloride C11H15ClFN 104774-94-9
R11-710 2011 4-Cyano-1-N-Fmoc-piperidine C21H20N2O2 391248-16-1
R11-711 2011 1-Boc-4-cyanopiperidine C11H18N2O2 91419-52-2
R11-712 2011 1-N-Cbz-4-cyanopiperidine C14H16N2O2 161609-84-3
R11-713 2011 1-Benzyl-4-cyanopiperidine C13H16N2 62718-31-4
R11-714 2011 (1-Boc-piperidin-4-yl)acetonitrile C12H20N2O2 256411-39-9
R11-715 2011 tert-Butyl 4-bromopiperidine-1-carboxylate C10H18BrNO2 180695-79-8
R11-716 2011 1-N-Boc-4-(4-Bromophenyl)piperidine C16H22BrNO2 769944-78-7
R11-717 2011 4-(4-bromophenyl)piperidine C11H15BrClN 80980-89-8
R11-718 2011 4-(4'-BROMOPHENYL)PIPERIDINE HYDROCHLORIDE C11H15BrClN 769944-79-8
R11-719 2011 Benzyl 4-(aminocarbonyl)tetrahydro-1(2H)-pyridinecarboxylate C14H18N2O3 167757-45-1
R11-720 2011 N-Boc-4-Piperidinecarboxamide C11H20N2O3 91419-48-6
R11-721 2011 4-(4'-Benzamide)piperidine C12H16N2O 886362-49-8
R11-722 2011 4-(2,4-Difluorophenyl)piperidine C11H13F2N 291289-50-4
R11-723 2011 4-(3,5-Difluorophenyl)piperidine C11H13F2N 412310-88-4
R11-724 2011 4-(4-Fluorophenyl)piperidine C11H14FN 37656-48-7
R11-725 2011 4-(4-Fluorophenyl)piperidine hydrochloride C11H14FN.HCl 6716-98-9
R11-726 2011 4-(4'-Fluorobenzyl)piperidine C12H16FN 92822-02-1
R11-727 2011 4-(3,5-Dichloro-phenyl)-piperidine C11H13Cl2N 475653-05-5
R11-728 2011 4-(3-chlorophenyl)-Piperidine C11H14ClN 99329-53-0
R11-729 2011 4-(4-Chlorophenyl)piperidine C11H14ClN 26905-02-2
R11-730 2011 1-Boc-4-chloropiperidine C10H18ClNO2 154874-94-9
R11-731 2011 4-Chloropiperidine hydrochloride C5H11NCl2 5382-19-4
R11-732 2011 4-phenyl-1-Piperidinecarboxylic acid 1,1-dimethylethyl ester C16H23NO2 123387-49-5
R11-733 2011 4'-N-Piperidinophenyl acetylene C13H15N 41876-66-8
R11-734 2011 4-(4-Methylphenyl)piperidine C12H17N 59083-39-5
R11-735 2011 4-Phenylpiperidine C11H15N 771-99-3
R11-736 2011 4-Phenylpiperidinehydrochloride C11H16NCl 10272-49-8
R11-737 2011 4-Phenylpiperidinehydrobromide C11H16NBr 16226-66-7
R11-738 2011 4-N-Fmoc-amino-piperidine hydrochloride C20H23ClN2O2 221352-86-9
R11-739 2011 1-(Methylsulfonyl)piperidin-4-amine hydrochloride C6H14N2O2S.HCl 651057-01-1
R11-740 2011 4-(Piperidin-4-ylamino)-benzoic acid ethyl ester C14H20N2O2 886362-80-7
R11-741 2011 4-Amino-1-Boc-piperidine C10H20N2O2 87120-72-7
R11-742 2011 tert-butyl 4-aminopiperidine-1-carboxylate hydrochloride C10H21ClN2O2 189819-75-8
R11-743 2011 4-N-Boc-Aminopiperidine C10H20N2O2 73874-95-0
R11-744 2011 1-Benzylpiperidin-4-amine C12H18N2 50541-93-0
R11-745 2011 4-Benzyloxycarbonylamino-N-Boc-piperdine C18H26N2O4 159874-20-1
R11-746 2011 1-Cbz-4-aminopiperidine C13H18N2O2 120278-07-1
R11-747 2011 tert-Butyl 4-[(methylamino)methyl]piperidine-1-carboxylate C12H24N2O2 138022-02-3
R11-748 2011 1-Boc-4-Methylaminopiperidine C11H22N2O2 147539-41-1
R11-749 2011 4-N-Boc-4-N-Methyl-aminopiperidine C11H22N2O2 108612-54-0
R11-750 2011 L-N-(4'-N-Cbz-Piperidino)proline C18H24N2O4 289677-06-1
R11-751 2011 4-(Phenylmethyl)piperidine C12H17N 31252-42-3
R11-752 2011 4-Piperidinopiperidine C10H20N2 4897-50-1
R11-753 2011 4-(4-Methoxyphenyl)piperidine C12H17NO 67259-62-5
R11-754 2011 4-(Aminomethyl)-1-(n-butyl)piperidine C10H22N2 65017-57-4
R11-755 2011 tert-butyl 4-amidinopiperidine-1-carboxylate C11H21N3O2 885270-23-5
R11-756 2011 3,4-Dihydro-7-(4-piperidinyl)-2(1H)-quinolinone C14H18N2O 886362-81-8
R11-757 2011 3-(2-Carboxy-acetyl)-piperidine-1-carboxylic acid benzyl ester C16H19NO5 886362-40-9
R11-758 2011 4-Hydroxypiperidine C5H11NO 5382-16-1
R11-759 2011 N-Boc-4-Hydroxypiperidine C10H19NO3 109384-19-2
R11-760 2011 Benzyl 4-hydroxy-1-piperidinecarboxylate C13H17NO3 95798-23-5
R11-761 2011 tert-Butyl 4-(hydroxyimino)piperidine-1-carboxylate C10H18N2O3 150008-24-5
R11-762 2011 4-Methoxypiperidine hydrochloride C6H14ClNO 4045-25-4
R11-763 2011 4-Piperidineethanol C7H15NO 622-26-4
R11-764 2011 1-Boc-4-(2-hydroxyethyl)piperidine C12H23NO3 89151-44-0
R11-765 2011 4-Piperidineethanol hydrochloride C7H14NO(HCl) 90747-17-4
R11-766 2011 4-piperidinethiol HCL C5H12ClNS 99201-86-2
R11-767 2011 (S)-3-Piperidinecarboxylic acid methyl ester hydrochloride C7H14ClNO2 164323-84-6
R11-768 2011 Methyl 4-(Boc-amino)piperidine-4-carboxylate C12H22N2O4 115655-44-2
R11-769 2011 1-Methylpiperidine-2-carboxylic acid hydrochloride C7H13NO2.HCl 25271-35-6
R11-770 2011 Ethyl piperidin-3-ylacetate C6H17NO2 64995-88-6
R11-771 2011 1-N-Cbz-3-aminopiperidine C13H18N2O2 711002-74-3
R11-772 2011 (S)-3-N-Boc-3-(methylamino)piperidine C11H22N2O2 309962-63-8
R11-773 2011 Cyclohexanecarboxylicacid, 4-amino-, hydrochloride (1:1), trans- C7H14ClNO2 27960-59-4
R11-774 2011 Boc-trans-4-aminocyclohexane-1-carboxylic acid C12H21NO4 53292-89-0
R11-775 2011 Methyl trans-4-Aminocyclohexanecarboxylate Hydrochloride C8H15NO2.HCl 61367-07-5
R11-776 2011 N-Boc-trans-1,4-cyclohexanediamine C11H22N2O2
R11-777 2011 tert-Butyl (trans-4-aminomethylcyclohexyl)carbamate C12H24N2O2 177583-27-6
R11-778 2011 N-Boc-cis-1,4-cyclohexyldiamine C11H22N2O2 247570-24-7
R11-779 2011 N-Boc-trans-1,4-cyclohexanediamine C11H22N2O2 177906-48-8
R11-780 2011 Carbamic acid,N-(cis-4-hydroxycyclohexyl)-, 1,1-dimethylethyl ester C11H21NO3 167081-25-6
R11-781 2011 trans-4-Boc-Aminocyclohexanol C11H21NO3 111300-06-2
R11-782 2011 4-aminocyclohexan-1-ol C6H13NO 56239-26-0
R11-783 2011 trans-1-Cbz-amino-4-hydroxycyclohexane C14H19NO3 16801-62-0
R11-784 2011 cis-4-Methylamino-cyclohexanol C7H15NO 22348-38-5
R11-785 2011 4-N-Boc-aminocyclohexanone C11H19NO3 179321-49-4
R11-786 2011 trans-Ethyl 4-hydroxycyclohexanecarboxylate C9H16O3 3618-04-0
R11-787 2011 trans-Methyl4-hydroxycyclohexanecarboxylate C8H14O3 6125-57-1
R11-788 2011 1H-Imidazole-4-carboxylic acid C4H4N2O2 1072-84-0
R11-789 2011 1-Methyl-1H-imidazole-4-carboxylic acid C5H6N2O2 41716-18-1
R11-790 2011 1H-Imidazole-5-carboxylic acid, methyl ester C5H6N2O2 17325-26-7
R11-791 2011 1H-Imidazole-4-carboxylic acid C6H8N2O2 17289-19-9
R11-792 2011 Ethyl imidazole-4-carboxylate C6H8N2O2 23785-21-9
R11-793 2011 1H-Imidazole-4-carboxylic acid, 1-methyl-, ethyl ester C7H10N2O2 41507-56-6
R11-794 2011 1H-Imidazole-4-carbaldehyde C4H4N2O 17289-26-8
R11-795 2011 1H-Imidazole-4-carbonitrile C4H3N3 57090-88-7
R11-796 2011 1-Methyl-1H-imidazole-4-carbonitrile C5H5N3 66121-69-5
R11-797 2011 4-Bromo-1-methyl-1H-imidazole C4H5BrN2 25676-75-9
R11-798 2011 1H-Imidazole,4-bromo-1,2-dimethyl- C5H7BrN2 850429-59-3
R11-799 2011 N-(4-Chlorophenyl)1-methyl-1H-imidazole-4-carboximidamide C11H11ClN4 959604-71-8
R11-800 2011 N-(4-Fluorophenyl)1-methyl-1H-imidazole-4-carboximidamide C11H11FN4 959604-70-7
R11-801 2011 Imidazole-4-methanol C4H6N2O 822-55-9
R11-802 2011 2-Bromo-1-methyl-1H-imidazole C4H5BrNO2 16681-59-7
R11-803 2011 1H-Imidazole,2-bromo-1,4-dimethyl C5H7BrN2 235426-30-9
R11-804 2011 1H-Imidazole,2-bromo-1,5-dimethyl C5H7BrN2 235426-31-0
R11-805 2011 2-Bromo-4-methyl-1H-imidazole C4H5BrN2 23328-88-3
R11-806 2011 1H-Imidazole,2-bromo-1-(ethoxymethyl)- C6H9BrN2O 850429-54-8
R11-807 2011 1H-Imidazole,2-chloro-1-(ethoxymethyl)- C6H9ClN2O 850429-55-9
R11-808 2011 1-Methyl-2-imidazolidinone C4H8N2O 694-32-6
R11-809 2011 1H-Imidazole,5-bromo-1,2-dimethyl- C5H7BrN3 24134-09-6
R11-810 2011 1-Methyl-1H-imidazole-5-carbaldehyde C5H6N2O 39021-62-0
R11-811 2011 1-Benzyl-1H-imidazole-5-carboxaldehyde C11H10N2O 85102-99-4
R11-812 2011 1H-Imidazole-5-carboxylic acid, methyl ester, hydrochloride C5H6N2O2.ClH 127607-71-0
R11-813 2011 1H-Imidazole-5-methanol,1-(phenylmethyl)- C11H12N2O 80304-50-3
R11-814 2011 1-Benzhydryl-3-methanesulfonatoazetidine C17H19NO3S 33301-41-6
R11-815 2011 1-Benzhydrylazetane-3-carbonitrile C17H16N2 36476-86-5
R11-816 2011 1-benzhydrylazetidin-3-one C16H15NO 40320-60-3
R11-817 2011 Methyl 1-(diphenylmethyl)azetidine-3-carboxylate C18H19NO2 53871-06-0
R11-818 2011 1-(Diphenylmethyl)-3-hydroxyazetidine hydrochloride C16H17NO 18621-17-5
R11-819 2011 1-Benzhydrylazetidin-3-ol hydrochloride C16H17NO.HCl 90604-02-7
R11-820 2011 1-Benzhydrylazetidine-3-carboxylic acid C17H17NO2 36476-87-6
R11-821 2011 Azetidine, 1-(diphenylmethyl)-3-fluoro- C16H16FN 617718-45-3
R11-822 2011 3-Hydroxyazetidine hydrochloride C3H7NO.HCl 18621-18-6
R11-823 2011 1-N-Boc-3-hydroxyazetidine C8H15NO3 141699-55-0
R11-824 2011 N-Cbz-3-hydroxyazetidine C11H13NO3 128117-22-6
R11-825 2011 Carbamic acid, (3-oxocyclobutyl)-, 1,1-dimethylethyl ester (9CI) C9H15NO3 154748-49-9
R11-826 2011 benzyl3-aminoazetidine-1-carboxy late C11H14N2O2 112257-20-2
R11-827 2011 1-Boc-3-(Amino)azetidine C8H16N2O2 193269-78-2
R11-828 2011 Carbamic acid, N-(3-azetidinylmethyl)-, phenylmethyl ester C12H16N2O2 876149-41-6
R11-829 2011 3-Boc-Aminoazetidine hydrochloride C8H16N2O2.HCl 217806-26-3
R11-830 2011 3-Boc-Aminoazetidine C8H16N2O2 91188-13-5
R11-831 2011 3-Aminohexahydro-2H-azepin-2-one hydrochloride C6H12N2O.HCl 99560-25-5
R11-832 2011 R-3-Aminohexahydro-2H-azepin-2-one hydrochloride C6H12N2O.HCl 26081-03-8
R11-833 2011 S-3-Aminohexahydro-2H-azepin-2-one hydrochloride C6H12N2O.HCl 26081-07-2
R11-834 2011 3-aminoazepan-2-one C6H12N2O 671-42-1
R11-835 2011 (R)-3-Amino-2-azepanone C6H12N2O 28957-33-7
R11-836 2011 (S)-a-Amino-omega-caprolactam C6H12N2O 21568-87-6
R11-837 2011 3-N-Boc-Amino-epsilon-caprolactam C11H20N2O3 179686-45-4
R11-838 2011 DL-Amino-omega-caprolactam C6H12N2O 17929-90-7
R11-839 2011 (R)-3-amino-1-methylazepan-2-one C7H14N2O
R11-840 2011 (S)-3-amino-1-methylazepan-2-one C7H14N2O 209983-96-0
R11-841 2011 (R)-3-amino-1-ethylazepan-2-one C8H16N2O 206434-44-8
R11-842 2011 (S)-3-Amino-1-ethyl-2-azepanone C8H16N2O 206434-45-9
R11-843 2011 (S)-3-Amino-1-ethyl-2-azepanone hydrochloride C8H17N2OCl 943843-30-9
R11-844 2011 (R)-3-amino-1-benzylazepan-2-one C13H18N2O 783368-48-9
R11-845 2011 (S)-3-Amino-1-benzylazepan-2-one C13H18N2O 209983-91-5
R11-846 2011 1-N-Boc-5-oxo-1,4-diazepane C10H18N2O3 190900-21-1
R11-847 2011 Benzyl (2-oxoazepan-3-yl)carbamate C14H18N2O3 108875-45-2
R11-848 2011 1,4-Diazepan-5-one hydrochloride C5H10N2O.HCl 208245-76-5
R11-849 2011 Carbamic acid,N-(hexahydro-2-oxo-1H-azepin-3-yl)-, 1,1-dimethylethyl ester C11H20N2O3 179686-45-4
R11-850 2011 1-Boc-3-oxo-1,4-diazepane C10H18N2O3 179686-38-5
R11-851 2011 1-Boc-3-(aminomethyl)azetidine C9H18N2O2 325775-44-8
R11-852 2011 3-(N-Boc-aminomethyl)azetidine C9H18N2O2 91188-15-7
R11-853 2011 3-Oxocyclobutanecarboxylic acid C5H6O3 23761-23-1
R11-854 2011 3-azetidinecarboxylic acid C4H7NO2 36476-78-5
R11-855 2011 1-N-Boc-3-Azetidinecarboxylic acid C9H15NO4 142253-55-2
R11-856 2011 1-Cbz-azetidine-3-carboxylic acid C12H13NO4 97628-92-7
R11-857 2011 Methyl azetidine-3-carboxylate hydrochloride C5H10ClNO2 100202-39-9
R11-858 2011 1-Boc-3-Cyanoazetidine C9H14N2O2 142253-54-1
R11-859 2011 1-Cbz-3-cyanoazetidine C12H12N2O2  288851-42-3 
R11-860 2011 3-fluoroazetidine C3H6FN 690257-76-2
R11-861 2011 3-Methylazetidine hydrochloride C4H10ClN 935669-28-6
R11-862 2011 3-(methoxymethyl)azetidine C5H11NO.ClH 942308-06-7
R11-863 2011 3-Azetidinone,1-(phenylmethyl)- C10H11NO 156303-83-2
R11-864 2011 2-Azetidinecarboxylic acid, 4-oxo- C4H5NO3 98019-65-9
R11-865 2011 tert-Butyl (1S,4S)-2,5-diazabicyclo[2.2.1]heptan-2-carboxylate C10H18N2O2 113451-59-5
R11-866 2011 3-Azetidinemethanamine hydrochloride C4H10N2 . 2ClH 221095-80-3
R11-867 2011 3-Hydroxyazetidine C3H7NO 45347-82-8
R11-868 2011 N-Boc-morpholine-3-carboxylic acid C10H17NO5 212650-43-6
R11-869 2011 (R)-Morpholine-3,4-dicarboxylic acid 4-tert-butylester C10H17NO5 869681-70-9
R11-870 2011 4-N-Boc-morpholine-3-acetic acid C11H19NO5 859155-89-8
R11-871 2011 (S)-Morpholine-3,4-dicarboxylic acid 4-tert-butylester C10H17NO5 783350-37-8
R11-872 2011 4-Boc-2-Hydroxymethylmorpholine C10H19NO4 135065-69-9
R11-873 2011 4-Boc-2-morpholinecarboxylic acid C10H17NO5 189321-66-2
R11-874 2011 N-(tert-Butoxycarbonyl)-4-bromoaniline C11H14BrNO2 131818-17-2
R11-875 2011 Boc-(4-aminophenyl)acetic acid C13H17NO4
R11-876 2011 2-Aminoethyl methyl sulfide C3H9NS 18542-42-2
R11-877 2011 N-Benzyloxycarbonyl-D-proline C13H15NO4 6404-31-5
R11-878 2011 N-Boc-D-proline C10H17NO4 37784-17-1
R11-879 2011 DL-Lysine monohydrate C6H14N2O2.H2O 885701-25-7
R11-880 2011 Ethyl 4-Boc-2-morpholinecarboxylate C12H21NO5 768371-16-0
R11-881 2011 2-Pyrrolidin-1-ylmethyl-piperidine C10H20N2 100158-63-2
R11-882 2011 (R)-2-Methyl-pyrrolidine C5H11N 41720-98-3
R11-883 2011 (S)-2-Methyl-pyrrolidine C5H11N 59335-84-1
R11-884 2011 (R)-2-Methylpyrrolidine hydrochloride C5H11N.HCl 135324-85-5
R11-885 2011 (S)-2-Methylpyrrolidine hydrochloride C5H11N.HCl 174500-74-4
R11-886 2011 (R)-2-(Aminomethyl)-1-Cbz-pyrrolidine C13H18N2O2 1187931-23-2
R11-887 2011 (S)-2-(Aminomethyl)-1-Cbz-pyrrolidine C13H18N2O2 119020-03-0
R11-888 2011 (R)-2-(Aminomethyl)-1-N-Boc-pyyrolidine C10H20N2O2 259537-92-3
R11-889 2011 (S)-1-N-Boc-2-(aminomethyl)pyrrolidine C10H20N2O2 119020-01-8
R11-890 2011 2-(Aminomethyl)-1-N-Boc-pyrrolidine C10H20N2O2 177911-87-4
R11-891 2011 (R)-2-(Aminomethyl)pyrrolidine C5H12N2 72300-69-7
R11-892 2011 (2R)-pyrrolidin-2-ylmethanamine dihydrochloride C5H13N2Cl 119020-04-1
R11-893 2011 (2S)-pyrrolidin-2-ylmethanamine dihydrochloride C5H13N2Cl 103382-84-9
R11-894 2011 (S)-2-(Aminomethyl)pyrrolidine C5H12N2 69500-64-7
R11-895 2011 (R)-2-(Aminoethyl)-1-N-Boc-pyrrolidine C11H22N2O2 550378-07-9
R11-896 2011 (S)-2-(Aminoethyl)-1-N-Boc-pyrrolidine C11H22N2O2 239483-09-1
R11-897 2011 1-(2-Aminoethyl)pyrrolidine C6H14N2 7154-73-6
R11-898 2011 L-Hydroxyproline C5H9NO3 51-35-4
R11-899 2011 (R)-(+)-1-Benzylpyrrolidine-2-methanol C12H17NO 182076-49-9
R11-900 2011 (S)-1-N-Benzyl-prolinol C12H17NO 53912-80-4
R11-901 2011 Boc-D-prolinol C10H19NO3 83435-58-9
R11-902 2011 2-Hydroxymethyl-pyrrolidine-1-carboxylicacidtert-butylester C10H19NO3 170491-63-1
R11-903 2011 LN-[(4'-Boc)piperidino]proline C15H26N2O4 221352-39-2
R11-904 2011 D-Pyrrolidine-2-carboxylic acid C5H9NO2 344-25-2
R11-905 2011 (S)-1- N-(benzyl)-l-proline C12H15NO2 31795-93-4
R11-906 2011 Boc-L-Proline C10H17NO4 15761-39-4
R11-907 2011 N-Boc-D-proline C10H17NO4 37784-17-1
R11-908 2011 N-Benzyloxycarbonyl-L-proline C13H15NO4 1148-11-4
R11-909 2011 N-Benzyloxycarbonyl-D-proline C13H15NO4 6404-31-5
R11-910 2011 N-Cbz-DL-proline C13H15NO4 5618-96-2
R11-911 2011 D-Prolinamide C5H10N2O 62937-45-5
R11-912 2011 (2R,4S)-4-Hydroxy-pyrrolidine-2-carboxylic acid C5H9NO3 3348-22-9
R11-913 2011 L-Prolinamide C5H10N2O 7531-52-4
R11-914 2011 1-Acetyl-2-pyrrolidinecarboxamide C7H12N2O2 30130-35-9
R11-915 2011 D-1-N-Boc-prolinamide C10H18N2O3 35150-07-3
R11-916 2011 tert-butyl 2-(aminocarbonyl)pyrrolidine-1-carboxylate C10H18N2O3 54503-10-5
R11-917 2011 diethyl pyrrolidine-2,5-dicarboxylate(HCl) C10H17NO4HCl 90979-49-0
R11-918 2011 2-(1-(benzyloxycarbonyl)pyrrolidin-2-yl)acetic acid C14H17NO4 889953-03-1
R11-919 2011 (S)-2-Pyrrolidineacetic acid, methyl ester C7H13NO2 53912-83-7
R11-920 2011 (R)-Methyl 2-(pyrrolidin-2-yl)acetate C7H13NO2 132482-05-4
R11-921 2011 (S)-Methyl 2-(pyrrolidin-2-yl)acetate hydrochloride C7H14NO2Cl 259868-83-2
R11-922 2011 (R)-Methyl 2-(pyrrolidin-2-yl)acetate hydrochloride C7H14NO2Cl 340040-67-7
R11-923 2011 (R)-1-Boc-2-cyanopyrrolidine C10H16N2O2 228244-20-0
R11-924 2011 (S)-1-Boc-2-cyanopyrrolidine C10H16N2O2 228244-04-0
R11-925 2011 1-N-Boc-2-pyrrolidinonitrile C10H16N2O2 144688-70-0
R11-926 2011 (R)-1-Cbz-2-cyano-pyrrolidine C13H14N2O2 620601-77-6
R11-927 2011 (S)-1-N-Cbz-2-cyano-pyrrolidine C13H14N2O2 63808-36-6
R11-928 2011 1-Boc-2-(N-hydroxycarbamimidoyl)pyrrolidine C10H19N3O3 500024-95-3
R11-929 2011 (R)-(-)-5-Hydroxymethylpyrrolidin-2-one C5H9NO2 66673-40-3
R11-930 2011 (S)-3-Hydroxypyrrolidin-2-one C4H7NO2 34368-52-0
R11-931 2011 L-Pyroglutaminol C5H9NO2 17342-08-4
R11-932 2011 (S)-1-Cbz-3-Aminopyrrolidine hydrochloride C12H16N2O2.HCl 550378-39-7
R11-933 2011 (R)-1-Cbz-3-Aminopyrrolidine hydrochloride C12H16N2O2.HCl 870621-17-3
R11-934 2011 (S)-3-N-Cbz-aminopyrrolidine C12H16N2O2 176970-12-0
R11-935 2011 (R)-3-N-Cbz-Aminopyrrolidine C12H16N2O2 879275-77-1
R11-936 2011 3-Cbz-Aminopyrrolidine C12H16N2O2 115551-46-7
R11-937 2011 (R)-3-tert-Butoxycarbonylaminopyrrolidine-1-carboxylic acid benzyl ester C17H24N2O4 122536-75-8
R11-938 2011 (S)-3-(Boc-amino)pyrrolidine C9H18N2O2 122536-76-9
R11-939 2011 (S)-(+)-1-Cbz-3-aminopyrrolidine C12H16N2O2 122536-72-5
R11-940 2011 (R)-3-Amino-1-N-Cbz-pyrrolidine C12H16N2O2 122536-73-6
R11-941 2011 (R)-3-(Boc-amino)pyrrolidine C9H18N2O2 122536-77-0
R11-942 2011 3-N-Boc-aminopyrrolidine C9H18N2O2 99724-19-3
R11-943 2011 (R)-(-)-1-Benzyl-3-aminopyrrolidine C11H16N2 114715-39-8
R11-944 2011 (S)-(+)-1-Benzyl-3-aminopyrrolidine C11H16N2 114715-38-7
R11-945 2011 1-Benzyl-3-aminopyrrolidine C11H16N2 18471-40-4
R11-946 2011 (R)-(+)-1-Boc-3-aminopyrrolidine C9H18N2O2 147081-49-0
R11-947 2011 (S)-(-)-1-Boc-3-aminopyrrolidine C9H18N2O2 147081-44-5
R11-948 2011 tert-Butyl 3-aminopyrrolidine-1-carboxylate C9H18N2O2 186550-13-0
R11-949 2011 (S)-(-)-1-Benzyl-3-(Boc-amino)pyrrolidine C16H24N2O2 131852-53-4
R11-950 2011 1-Benzyl-3-(Boc-amino)pyrrolidine C16H24N2O2 99735-30-5
R11-951 2011 (R)-1-Benzyl-3-(Boc-amino)pyrrolidine C16H24N2O2 131878-23-4
R11-952 2011 (R)-3-Aminopyrrolidine C4H10N2 116183-82-5
R11-953 2011 (3R)-3-Aminopyrrolidine dihydrochloride C4H10N2.2(HCl) 116183-81-4
R11-954 2011 (S)-3-Aminopyrroline dihydrochloride C4H12Cl2N2 116183-83-6
R11-955 2011 3-Pyrrolidinamine,1-(1-methylethyl)- C7H18Cl2N2 19985-09-2
R11-956 2011 1-Boc-3-Methylaminopyrrolidine C10H20N2O2 454712-26-6
R11-957 2011 (R)-(+)-3-(Dimethylamino)pyrrolidine dihydrochloride C6H14N2.2(HCl) 864448-61-3
R11-958 2011 (S)-3-Dimethylaminopyrrolidine 2HCL C6H14N2.2(HCl) 144043-20-9
R11-959 2011 1-Pyrrolidinecarboxylicacid, 3-(dimethylamino)-, 1,1-dimethylethyl ester, (3R)- C11H22N2O2 1004538-33-3
R11-960 2011 (S)-1-Boc-3-(aminomethyl)pyrrolidine C10H20N2O2 199175-10-5
R11-961 2011 (R)-N-Boc-3-(aminomethyl)pyrrolidine C11H22N2O2 199174-29-3
R11-962 2011 3-Aminoethyl-1-N-Cbz-pyrrolidine C14H20N2O2 811842-07-6
R11-963 2011 (S)-1-N-Boc-3-hydroxy-pyrrolidine C9H17NO3 101469-92-5
R11-964 2011 (R)-(-)-N-Boc-3-pyrrolidinol C9H17NO3 109431-87-0
R11-965 2011 1-Boc-3-hydroxypyrrolidine C9H17O3N 103057-44-9
R11-966 2011 (S)-3-Hydroxypyrrolidine hydrochloride C4H9NO.HCl 122536-94-1
R11-967 2011 3-Hydroxypyrrolidine hydrochloride C4H9NO.HCl 86070-82-8
R11-968 2011 (R)-1-N-Benzyl-3-pyrrolidine C11H15NO 101930-07-8
R11-969 2011 (S)-1-Benzyl-3-pyrrolidinol C11H15NO 101385-90-4
R11-970 2011 N-Benzyl-3-pyrrolidinol C11H15NO 775-15-5
R11-971 2011 (R)--1-Cbz-3-pyrrolidinol C12H15NO3 100858-33-1
R11-972 2011 (S)-1-Cbz-3-Pyrrolidinol C12H15NO3 100858-32-0
R11-973 2011 (R)-3-Hydroxypyrrolidine C4H9NO 2799-21-5
R11-974 2011 (S)-(+)-1-Methyl-3-pyrrolidinol C5H11NO 104641-59-0
R11-975 2011 N-Boc-3-pyrrolidineacetic acid C11H19NO4 175526-97-3
R11-976 2011 1-N-Cbz-pyrrolidine-3-acetic acid C14H17NO4 886362-65-8
R11-977 2011 (S)-3-Methyl-Pyrrolidine hydrochloride C5H12ClN 186597-29-5
R11-978 2011 (R)-3-Methyl-pyrrolidine hydrochloride C5H11N HCl 235093-98-8
R11-979 2011 3-Methyl-pyrrolidine hydrochloride C5H11N HCl 120986-92-7
R11-980 2011 (R)-1-Boc-3-Cyanopyrrolidine C10H16N2O2 132945-76-7
R11-981 2011 (S)-1-N-Boc-3-Cyano-pyrrolidine C10H16N2O2 132945-78-9
R11-982 2011 1-N-Boc-3-Cyanopyrrolidine C10H16N2O2 476493-40-0
R11-983 2011 1-Boc-3-cyano-4-oxopyrrolidine C10H14N2O3 175463-32-8
R11-984 2011 (S)-1-N-Benzy-balta-proline C12H15NO2 161659-80-9
R11-985 2011 (R)-1-N-Benzyl-beta-proline C12H15NO2 216311-57-8
R11-986 2011 1-Boc-pyrrolidine-3-carboxylic acid C10H17NO4 59378-75-5
R11-987 2011 (S)-N-Boc-pyrrolidine-3-carboxylic acid C10H17NO4 140148-70-5
R11-988 2011 (R)-1-tert-Butoxycarbonyl-pyrrolidine-3-carboxylic acid C10H17NO4 72925-16-7
R11-989 2011 Methyl 3-pyrrolidinecarboxylate C6H11NO2 98548-90-4
R11-990 2011 (S)-methyl pyrrolidine-3-carboxylate C6H11NO2 216311-60-3
R11-991 2011 Methyl 3-pyrrolidinecarboxylate hydrochloride C6H11NO2.HCl 198959-37-4
R11-992 2011 (3R)-1-Methylpyrrolidine-3-carboxylate hydrochloride C6H11NO2 428518-43-8
R11-993 2011 S-3-Pyrrolidinecarboxylic acid methyl ester hydrochloride C6H12ClNO2 1099646-61-3
R11-994 2011 (R)-1-Boc-3-methanesulfonyloxypyrrolidine C10H19NO5S 127423-61-4
R11-995 2011 (S)-1-Boc-3-methanesulfonyloxypyrrolidine C10H19NO5S 132945-75-6
R11-996 2011 1-Boc-3-methanesulfonyloxypyrrolidine C10H19NO5S 141699-57-2
R11-997 2011 1-N-Ethoxycarbonyl-3-pyrrolidone C7H11NO3 14891-10-2
R11-998 2011 (3S)-(-)-3-Acetamidopyrrolidine C6H12N2O 114636-31-6
R11-999 2011 (3S)-(-)-3-Acetamidopyrrolidine hydrochloride C6H13N2OCl 1246277-44-0

 

Rintech Home  |   Copyright Statement  |   Site Map

Copyright © from 1998---present. RINTECH Inc., Maryland (in Greater Washington DC Area), USA. All rights reserved.